RegulonDB RegulonDB 10.7: Gene Form
   

yegX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegX thiD yegW yegV thiM terminator yegXp6 yegXp6 yegXp1 yegXp1

Gene      
Name: yegX    Texpresso search in the literature
Synonym(s): ECK2095, G7134, b2102
Genome position(nucleotides): 2182833 <-- 2183651 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.99
External database links:  
ASAP:
ABE-0006955
ECHOBASE:
EB3820
OU-MICROARRAY:
b2102
PORTECO:
yegX
REGULONDB:
b2102
STRING:
511145.b2102
M3D: yegX
COLOMBOS: yegX
PortEco: b2102


Product      
Name: putative hydrolase
Synonym(s): YegX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 31.604
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
70 -> 245 IDVSRWQERIDWQRVAKMRDNGIRLQFAFIKATEGEKLVDPYFSRNWQLSRENGLLRGAYHYFSPSVSASVQARLFLQTVDFSQGDFPAVLDVEERGKLSAKELRKRVSQWLKMVEKSTGKKPIIYSGAVFYHTNLAGYFNEYPWWVAHYYQRRPDNDGMAWRFWQHSDRGQVDGI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0003796 - lysozyme activity
biological_process GO:0008152 - metabolic process
GO:0009253 - peptidoglycan catabolic process
GO:0016998 - cell wall macromolecule catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH25
ECOCYC:
G7134-MONOMER
ECOLIWIKI:
b2102
INTERPRO:
IPR018077
INTERPRO:
IPR008270
INTERPRO:
IPR002053
INTERPRO:
IPR017853
MODBASE:
P76421
PFAM:
PF01183
PRIDE:
P76421
PROSITE:
PS00953
PROTEINMODELPORTAL:
P76421
REFSEQ:
NP_416605
SMART:
SM00641
SMR:
P76421
UNIPROT:
P76421


Operon      
Name: yegX         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegXp1 2183801 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yegXp6 2183820 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB