RegulonDB RegulonDB 10.7: Gene Form
   

rcnR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcnA thiM rcnR thiD Fur Fur Fur RcnR RcnR Cis-reg; riboswitch terminator rcnRp rcnRp rcnAp rcnAp thiMp thiMp thiDp3 thiDp3

Gene      
Name: rcnR    Texpresso search in the literature
Synonym(s): ECK2098, G7137, b2105, yohL
Genome position(nucleotides): 2185524 <-- 2185796 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.35
External database links:  
ASAP:
ABE-0006964
ECHOBASE:
EB3823
OU-MICROARRAY:
b2105
PORTECO:
rcnR
REGULONDB:
b2105
STRING:
511145.b2105
M3D: rcnR
COLOMBOS: rcnR
PortEco: b2105


Product      
Name: DNA-binding transcriptional repressor RcnR
Synonym(s): RcnR, YohL
Sequence: Get amino acid sequence Fasta Format
Regulator Family: RcnR_FrmR_like_DUF156
Cellular location: cytosol
Molecular weight: 10.134
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence
7 -> 86 DKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTEHIVHQGDELKREEDLDVVLKVLD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
Reference(s): [1] Iwig JS., et al., 2009
[2] Iwig JS., et al., 2006
[3] Koch D., et al., 2007
External database links:  
ECOCYC:
G7137-MONOMER
ECOLIWIKI:
b2105
INTERPRO:
IPR003735
INTERPRO:
IPR038390
PANTHER:
PTHR33677
PFAM:
PF02583
PRIDE:
P64530
PRODB:
PRO_000023688
PROTEINMODELPORTAL:
P64530
REFSEQ:
NP_416608
SMR:
P64530
UNIPROT:
P64530


Operon      
Name: rcnR         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: RcnR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter thiDp3 2184673 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Iwig JS., Chivers PT., 2009, DNA recognition and wrapping by Escherichia coli RcnR., J Mol Biol 393(2):514-26

 [2] Iwig JS., Rowe JL., Chivers PT., 2006, Nickel homeostasis in Escherichia coli - the rcnR-rcnA efflux pathway and its linkage to NikR function., Mol Microbiol 62(1):252-62

 [3] Koch D., Nies DH., Grass G., 2007, The RcnRA (YohLM) system of Escherichia coli: a connection between nickel, cobalt and iron homeostasis., Biometals 20(5):759-71

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB