RegulonDB RegulonDB 10.8: Gene Form
   

rcnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehA rcnA rcnB Fur Fur rcnBp rcnBp

Gene      
Name: rcnB    Texpresso search in the literature
Synonym(s): ECK2100, G7139, b2107, yohN
Genome position(nucleotides): 2186960 --> 2187298 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.85
External database links:  
ASAP:
ABE-0006970
ECHOBASE:
EB3825
OU-MICROARRAY:
b2107
PortEco:
yohN
STRING:
511145.b2107
COLOMBOS: rcnB


Product      
Name: periplasmic protein involved in nickel/cobalt export
Synonym(s): RcnB, YohN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 12.466
Isoelectric point: 7.746
Motif(s):
 
Type Positions Sequence
1 -> 25 MTIKNKMLLGALLLVTSAAWAAPAT
52 -> 101 GDTVPEMYRTDEYNIKQWQLRNLPAPDAGTHWTYMGGAYVLISDTDGKII
26 -> 112 AGSTNTSGISKYELSSFIADFKHFKPGDTVPEMYRTDEYNIKQWQLRNLPAPDAGTHWTYMGGAYVLISDTDGKIIKAYDGEIFYHR
86 -> 86 M
82 -> 86 HWTYM

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005507 - copper ion binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0010045 - response to nickel cation
GO:0032025 - response to cobalt ion
GO:1901652 - response to peptide
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IFC] Inferred by functional complementation
Reference(s): [1] Bleriot C., et al., 2011
External database links:  
DIP:
DIP-48070N
ECOCYC:
G7139-MONOMER
ECOLIWIKI:
b2107
INTERPRO:
IPR024572
PFAM:
PF11776
PRIDE:
P64534
PRODOM:
PD456999
REFSEQ:
NP_416610
SMR:
P64534
UNIPROT:
P64534


Operon      
Name: rcnAB         
Operon arrangement:
Transcription unit        Promoter
rcnAB
 


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, RcnR


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rcnBp 2186884 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bleriot C., Effantin G., Lagarde F., Mandrand-Berthelot MA., Rodrigue A., 2011, RcnB is a periplasmic protein essential for maintaining intracellular Ni and Co concentrations in Escherichia coli., J Bacteriol 193(15):3785-93

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB