RegulonDB RegulonDB 10.8: Gene Form
   

lpxT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiR lpxT mepS anti-anti-terminator TSS_2474 TSS_2474 mepSp mepSp mepSp2 mepSp2 lpxTp lpxTp

Gene      
Name: lpxT    Texpresso search in the literature
Synonym(s): ECK2168, G7146, b2174, yeiU
Genome position(nucleotides): 2268854 --> 2269567 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.12
External database links:  
ASAP:
ABE-0007196
ECHOBASE:
EB3828
OU-MICROARRAY:
b2174
PortEco:
lpxT
STRING:
511145.b2174
COLOMBOS: lpxT


Product      
Name: Kdo2-lipid A phosphotransferase
Synonym(s): LpxT, YeiU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.759
Isoelectric point: 10.511
Motif(s):
 
Type Positions Sequence
170 -> 189 GLIALIIFVVFAFPRVMIGA
168 -> 188 VAGLIALIIFVVFAFPRVMIG
146 -> 166 FPGDHGMMLLIFSAFMWRYFG
195 -> 215 IIVGSMTVILIGLPWVLLTPL
133 -> 207 LLSVPTKDASRDSFPGDHGMMLLIFSAFMWRYFGKVAGLIALIIFVVFAFPRVMIGAHWFTDIIVGSMTVILIGL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016776 - phosphotransferase activity, phosphate group as acceptor
GO:0050380 - undecaprenyl-diphosphatase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7146-MONOMER
ECOLIWIKI:
b2174
INTERPRO:
IPR036938
INTERPRO:
IPR000326
INTERPRO:
IPR032908
MODBASE:
P76445
PFAM:
PF01569
PRIDE:
P76445
REFSEQ:
NP_416679
SMART:
SM00014
UNIPROT:
P76445


Operon      
Name: yeiR-lpxT         
Operon arrangement:
Transcription unit        Promoter
lpxT
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2474 2269943 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB