RegulonDB RegulonDB 10.8: Gene Form
   

yfaU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaV rpnE yfaU ypaA rhmAp3 rhmAp3

Gene      
Name: yfaU    Texpresso search in the literature
Synonym(s): ECK2238, G7158, b2245
Genome position(nucleotides): 2358042 <-- 2358845 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0007431
ECHOBASE:
EB3836
OU-MICROARRAY:
b2245
PortEco:
yfaU
STRING:
511145.b2245
COLOMBOS: yfaU


Product      
Name: 2-keto-3-deoxy-L-rhamnonate aldolase
Synonym(s): YfaU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.916
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
49 -> 49 H
74 -> 74 R
19 -> 244 QIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0106099 - 2-keto-3-deoxy-L-rhamnonate aldolase activity
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
GO:0016151 - nickel cation binding
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006725 - cellular aromatic compound metabolic process
GO:0034214 - protein hexamerization
Note(s): Note(s): ...[more].
Reference(s): [1] Wright A., et al., 2002
External database links:  
DIP:
DIP-11953N
ECOCYC:
G7158-MONOMER
ECOLIWIKI:
b2245
INTERPRO:
IPR005000
INTERPRO:
IPR023593
INTERPRO:
IPR015813
INTERPRO:
IPR040442
MODBASE:
P76469
PDB:
2VWS
PDB:
2VWT
PFAM:
PF03328
PRIDE:
P76469
REFSEQ:
NP_416748
SMR:
P76469
SWISSMODEL:
P76469
UNIPROT:
P76469


Operon      
Name: yfaX-rhmD-yfaVU         
Operon arrangement:
Transcription unit        Promoter
yfaXWVU
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rhmAp3 2358946 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wright A., Blewett A., Fulop V., Cooper R., Burrows S., Jones C., Roper D., 2002, Expression, purification, crystallization and preliminary characterization of an HHED aldolase homologue from Escherichia coli K12., Acta Crystallogr D Biol Crystallogr 58(Pt 12):2191-3

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB