RegulonDB RegulonDB 10.8: Gene Form
   

yfaV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaV rhmD yfaU terminator rhmAp3 rhmAp3

Gene      
Name: yfaV    Texpresso search in the literature
Synonym(s): ECK2239, G7159, b2246
Genome position(nucleotides): 2358863 <-- 2360152 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.71
External database links:  
ASAP:
ABE-0007433
ECHOBASE:
EB3837
OU-MICROARRAY:
b2246
PortEco:
yfaV
STRING:
511145.b2246
COLOMBOS: yfaV


Product      
Name: putative transporter YfaV
Synonym(s): RhmT, YfaV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.294
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
17 -> 37 LIPFMLALYVLAFLDRSNIGF
23 -> 381 ALYVLAFLDRSNIGFAKQTYQIDTGLSNEAYALGAGIFFVVYAFLGVPANLLMRKLGARTWIGTTTLLWGFLSAAMAWADTEAKFLIVRTLLRAAEAGFFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAVGAGVFTFFWLDDTPEQARFLSKQEKTLLINQLASEEQQKVTSRLSDALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWVAALFGTWLIPRYSDKTGERRNVAALTLLAAGIGIGLSGLLSPVMAIVALCVAAIGFIAVQPVFWTMPTQLLSGTALAAGIGFVNLFGAVGGFIAP
362 -> 382 LAAGIGFVNLFGAVGGFIAPI
55 -> 75 LGAGIFFVVYAFLGVPANLLM
243 -> 263 LAIIYLTIQVAVYGLIFFLPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031224 - intrinsic component of membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
B2246-MONOMER
ECOLIWIKI:
b2246
INTERPRO:
IPR011701
INTERPRO:
IPR036259
INTERPRO:
IPR020846
MODBASE:
P76470
PFAM:
PF07690
PRIDE:
P76470
PROSITE:
PS50850
REFSEQ:
NP_416749
SMR:
P76470
UNIPROT:
P76470


Operon      
Name: yfaX-rhmD-yfaVU         
Operon arrangement:
Transcription unit        Promoter
yfaXWVU
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rhmAp3 2358946 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB