RegulonDB RegulonDB 10.8: Gene Form
   

yfaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaY yfaX yfaZ anti-anti-terminator anti-terminator terminator terminator yfaYp yfaYp

Gene      
Name: yfaY    Texpresso search in the literature
Synonym(s): ECK2242, G7162, b2249
Genome position(nucleotides): 2362431 <-- 2363633 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.2
External database links:  
ASAP:
ABE-0007441
ECHOBASE:
EB3840
OU-MICROARRAY:
b2249
PortEco:
yfaY
STRING:
511145.b2249
COLOMBOS: yfaY


Product      
Name: IPR008135 CinA family protein YfaY
Synonym(s): YfaY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.226
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
6 -> 170 MLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQHADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHEAWLKEMERYFHERGRVMAPSNRKQAELPASAEFINNPVGTACGFAVQLNRCLMFFTPGVPSEFKVMVEHEILPRLR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9281N
ECOCYC:
G7162-MONOMER
ECOLIWIKI:
b2249
INTERPRO:
IPR036653
INTERPRO:
IPR008135
INTERPRO:
IPR001453
INTERPRO:
IPR036425
MODBASE:
P77808
PFAM:
PF00994
PRIDE:
P77808
REFSEQ:
NP_416752
SMART:
SM00852
SMR:
P77808
UNIPROT:
P77808


Operon      
Name: yfaY         
Operon arrangement:
Transcription unit        Promoter
yfaY


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB