RegulonDB RegulonDB 10.8: Gene Form
   

elaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menF elaA elaB OxyR terminator TSS_2525 TSS_2525 elaBp elaBp TSS_2523 TSS_2523 TSS_2522 TSS_2522

Gene      
Name: elaB    Texpresso search in the literature
Synonym(s): ECK2260, G7173, b2266, yfbD
Genome position(nucleotides): 2380722 <-- 2381027 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.96
External database links:  
ASAP:
ABE-0007487
ECHOBASE:
EB2977
OU-MICROARRAY:
b2266
PortEco:
elaB
STRING:
511145.b2266
COLOMBOS: elaB


Product      
Name: tail-anchored inner membrane protein ElaB
Synonym(s): ElaB, YfbD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 11.306
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
10 -> 101 IDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDSYYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR
80 -> 99 PWQGIGVGAAVGLVLGLLLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0043022 - ribosome binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0033554 - cellular response to stress
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47919N
ECOCYC:
G7173-MONOMER
ECOLIWIKI:
b2266
INTERPRO:
IPR010279
MINT:
MINT-1311168
PANTHER:
PTHR35893
PFAM:
PF05957
PRIDE:
P0AEH5
PRODB:
PRO_000022506
REFSEQ:
NP_416769
UNIPROT:
P0AEH5


Operon      
Name: elaB         
Operon arrangement:
Transcription unit        Promoter
elaB


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2522 2380846 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2523 2381050 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2525 2381535 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB