RegulonDB RegulonDB 10.8: Gene Form
   

elaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rbn elaA elaB OxyR elaAp4 elaAp4 elaAp3 elaAp3 TSS_2528 TSS_2528 rbnp4 rbnp4 TSS_2527 TSS_2527 TSS_2526 TSS_2526 TSS_2525 TSS_2525 elaBp elaBp TSS_2523 TSS_2523 TSS_2522 TSS_2522

Gene      
Name: elaA    Texpresso search in the literature
Synonym(s): ECK2261, G7174, b2267, yfbC
Genome position(nucleotides): 2381082 <-- 2381543 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.84
External database links:  
ASAP:
ABE-0007489
ECHOBASE:
EB2976
OU-MICROARRAY:
b2267
PortEco:
elaA
STRING:
511145.b2267
COLOMBOS: elaA


Product      
Name: putative N-acetyltransferase ElaA
Synonym(s): ElaA, YfbC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.42
Isoelectric point: 4.482
Motif(s):
 
Type Positions Sequence
121 -> 121 Q
44 -> 149 LTGDNRHILGWKNDELVAYARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHWPDKPVYLGAQAHLQNFYQSFGFIPVTEVYEEDGIPHIGMARE
7 -> 151 LHHSELSVSQLYALLQLRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELVAYARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHWPDKPVYLGAQAHLQNFYQSFGFIPVTEVYEEDGIPHIGMAREVI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008080 - N-acetyltransferase activity
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7174-MONOMER
ECOLIWIKI:
b2267
INTERPRO:
IPR016181
INTERPRO:
IPR000182
MODBASE:
P0AEH3
PDB:
5Z6N
PFAM:
PF13673
PRIDE:
P0AEH3
PRODB:
PRO_000022505
PROSITE:
PS51186
REFSEQ:
NP_416770
SMR:
P0AEH3
SWISSMODEL:
P0AEH3
UNIPROT:
P0AEH3


Operon      
Name: elaA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2522 2380846 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2523 2381050 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2525 2381535 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2526 2381563 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2527 2381565 reverse nd [RS-EPT-CBR] [1]
  promoter rbnp4 2381581 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2528 2381582 forward nd [RS-EPT-CBR] [1]
  promoter elaAp3 2381614 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter elaAp4 2381686 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB