RegulonDB RegulonDB 10.8: Gene Form
   

yfbK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfbK elaD yfbL yfbKp7 yfbKp7 yfbLp7 yfbLp7 yfbLp10 yfbLp10 yfbKp3 yfbKp3 yfbLp9 yfbLp9 yfbLp3 yfbLp3 yfbLp5 yfbLp5 TSS_2529 TSS_2529

Gene      
Name: yfbK    Texpresso search in the literature
Synonym(s): ECK2264, G7177, b2270
Genome position(nucleotides): 2383995 <-- 2385722 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.22
External database links:  
ASAP:
ABE-0007501
ECHOBASE:
EB3848
OU-MICROARRAY:
b2270
PortEco:
yfbK
STRING:
511145.b2270
COLOMBOS: yfbK


Product      
Name: IPR002035/DUF3520 domain-containing protein YfbK
Synonym(s): YfbK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 63.634
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
101 -> 199 GTARYQQFDDNPVKQVAQNPLATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPFAMRYELAPAPWNEQRTLLK
393 -> 568 MLITVAKDVKAQIEFNPAWVTEYRQIGYEKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKELAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQIKQWAQQAKGEDPQGYRAEFIRLIELAD
216 -> 394 NLVFLIDTSGSMISDERLPLIQSSLKLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINRILLATDGDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDTLSEAQKVLNSEMRQML

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7177-MONOMER
ECOLIWIKI:
b2270
INTERPRO:
IPR022156
INTERPRO:
IPR036465
INTERPRO:
IPR021908
INTERPRO:
IPR002035
MODBASE:
P76481
PFAM:
PF12450
PFAM:
PF00092
PFAM:
PF12034
PRIDE:
P76481
PROSITE:
PS50234
PROSITE:
PS51257
REFSEQ:
NP_416773
SMART:
SM00327
SMR:
P76481
UNIPROT:
P76481


Operon      
Name: yfbK         
Operon arrangement:
Transcription unit        Promoter
yfbK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2529 2385404 forward nd [RS-EPT-CBR] [1]
  promoter yfbLp5 2385750 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp3 2385760 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp9 2385769 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbKp3 2385784 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp10 2385805 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp7 2385828 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbKp7 2385905 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB