RegulonDB RegulonDB 10.8: Gene Form
   

yfbS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfbS hxpA yfbR anti-anti-terminator anti-terminator terminator TSS_2580 TSS_2580 TSS_2579 TSS_2579 TSS_2578 (cluster) TSS_2578 (cluster) TSS_2577 TSS_2577 TSS_2576 TSS_2576 TSS_2575 (cluster) TSS_2575 (cluster) TSS_2574 TSS_2574 TSS_2573 (cluster) TSS_2573 (cluster) TSS_2572 TSS_2572 TSS_2571 TSS_2571 TSS_2570 (cluster) TSS_2570 (cluster)

Gene      
Name: yfbS    Texpresso search in the literature
Synonym(s): ECK2286, G7186, b2292
Genome position(nucleotides): 2409520 <-- 2411352 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.26
External database links:  
ASAP:
ABE-0007565
ECHOBASE:
EB3856
OU-MICROARRAY:
b2292
PortEco:
yfbS
STRING:
511145.b2292
COLOMBOS: yfbS


Product      
Name: putative transporter YfbS
Synonym(s): YfbS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 65.872
Isoelectric point: 8.756
Motif(s):
 
Type Positions Sequence
29 -> 49 VALFVIVAFALSGTLTVPEVF
503 -> 523 YGPHMMLGCLFVLSAVIGLFI
136 -> 156 LMMPLSFAGLISGMMTLVATP
218 -> 307 RDLIREYRLTGRARRLAIRPGSPMIGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAADVDLRQFCSEQLL
231 -> 304 RRLAIRPGSPMIGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAADVDLRQFCSE

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008324 - cation transmembrane transporter activity
biological_process GO:0006813 - potassium ion transport
GO:0055085 - transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-48033N
ECOCYC:
G7186-MONOMER
ECOLIWIKI:
b2292
INTERPRO:
IPR004680
INTERPRO:
IPR036721
INTERPRO:
IPR031312
INTERPRO:
IPR006037
MINT:
MINT-1256616
PFAM:
PF03600
PFAM:
PF02080
PRIDE:
P0AFU2
PROSITE:
PS01271
PROSITE:
PS51202
REFSEQ:
NP_416795
SMR:
P0AFU2
UNIPROT:
P0AFU2


Operon      
Name: yfbS         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2570 (cluster) 2409942 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2571 2409945 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2572 2409947 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2573 (cluster) 2409960 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2574 2410159 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2575 (cluster) 2410629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2576 2410812 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2577 2410818 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2578 (cluster) 2411098 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2579 2411731 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2580 2411792 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB