RegulonDB RegulonDB 10.8: Gene Form
   

yfbU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hxpA yfbU yfbV anti-terminator terminator anti-anti-terminator anti-terminator TSS_2585 TSS_2585 TSS_2584 TSS_2584 TSS_2583 TSS_2583 TSS_2582 (cluster) TSS_2582 (cluster) yfbUp yfbUp TSS_2581 TSS_2581 TSS_2580 TSS_2580 TSS_2579 TSS_2579

Gene      
Name: yfbU    Texpresso search in the literature
Synonym(s): ECK2288, G7188, b2294
Genome position(nucleotides): 2412100 <-- 2412594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.68
External database links:  
ASAP:
ABE-0007571
ECHOBASE:
EB3858
OU-MICROARRAY:
b2294
PortEco:
yfbU
STRING:
511145.b2294
COLOMBOS: yfbU


Product      
Name: UPF0304 family protein YfbU
Synonym(s): YfbU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.536
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
1 -> 164 MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48184N
ECOCYC:
G7188-MONOMER
ECOLIWIKI:
b2294
INTERPRO:
IPR023146
INTERPRO:
IPR023145
INTERPRO:
IPR005587
PDB:
4LR3
PFAM:
PF03887
PRIDE:
P0A8W8
PRODOM:
PD035118
REFSEQ:
NP_416797
SMR:
P0A8W8
SWISSMODEL:
P0A8W8
UNIPROT:
P0A8W8


Operon      
Name: yfbU-hxpA         
Operon arrangement:
Transcription unit        Promoter
yfbU-hxpA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2579 2411731 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2580 2411792 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2581 2412114 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2582 (cluster) 2412636 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2583 2412645 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2584 2412647 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2585 2412788 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB