RegulonDB RegulonDB 10.8: Gene Form
   

yfcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pta yfcC yfcD terminator anti-terminator anti-anti-terminator TSS_2612 TSS_2612 TSS_2611 TSS_2611 TSS_2610 TSS_2610 TSS_2609 TSS_2609 TSS_2608 TSS_2608 TSS_2607 TSS_2607 TSS_2606 (cluster) TSS_2606 (cluster) TSS_2605 TSS_2605 TSS_2604 TSS_2604

Gene      
Name: yfcC    Texpresso search in the literature
Synonym(s): ECK2292, G7190, b2298
Genome position(nucleotides): 2417081 --> 2418601 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.07
External database links:  
ASAP:
ABE-0007585
ECHOBASE:
EB2491
OU-MICROARRAY:
b2298
PortEco:
yfcC
STRING:
511145.b2298
COLOMBOS: yfcC


Product      
Name: putative transporter YfcC
Synonym(s): YfcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 54.797
Isoelectric point: 7.146
Motif(s):
 
Type Positions Sequence
419 -> 439 SGQAALTMPLLAPLGDLVGVN
86 -> 90 GDERP
107 -> 127 GTAVGIIMFMLVIGGAFGIVM
442 -> 462 VTVLAFQFGDGFSHIIYPTSA
15 -> 501 MPDTLVIIFFVAILTSLATWVVPVGMFDSQEVQYQVDGQTKTRKVVDPHSFRILTNEAGEPEYHRVQLFTTGDERPGLMNFPFEGLTSGSKYGTAVGIIMFMLVIGGAFGIVMRTGTIDNGILALIRHTRGNEILFIPALFILFSLGGAVFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAGVPVLSGSGLRIVVWVIATLIGLIFTMVYASRVKKNPLLSRVHESDRFFREKQADVEQRPFTFGDWLVLIVLTAVMVWVIWGVIVNAWFIPEIASQFFTMGLVIGIIGVVFRLNGMTVNTMASSFTEGARMMIAPALLVGFAKGILLLVGNGEAGDASVLNTILNSIANAISGLDNAVAAWFMLLFQAVFNFFVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIYPTSASLMATLGVCRVDFRNWLKVGATLLGLLFIMSSVVVIGAQ

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015297 - antiporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Wang X., et al., 2014
External database links:  
DIP:
DIP-11977N
ECOCYC:
G7190-MONOMER
ECOLIWIKI:
b2298
INTERPRO:
IPR018385
MINT:
MINT-1315864
PFAM:
PF03606
PRIDE:
P39263
REFSEQ:
NP_416801
UNIPROT:
P39263


Operon      
Name: yfcC         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2604 2415098 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2605 2415351 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2606 (cluster) 2415354 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2607 2415750 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2608 2415781 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2609 2415814 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2610 2415818 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2611 2416038 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2612 2416149 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Wang X., Gao P., Xu G., 2014, [Hydrophilic interaction liquid chromatography coupled with mass spectrometry for metabolomic analysis of Escherichia coli]., Se Pu 32(10):1084-93

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB