RegulonDB RegulonDB 10.8: Gene Form
   

yfcF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcG yfcF yfcE

Gene      
Name: yfcF    Texpresso search in the literature
Synonym(s): ECK2295, G7193, b2301
Genome position(nucleotides): 2419841 <-- 2420485 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.63
External database links:  
ASAP:
ABE-0007593
ECHOBASE:
EB3862
OU-MICROARRAY:
b2301
PortEco:
yfcF
STRING:
511145.b2301
COLOMBOS: yfcF


Product      
Name: glutathione S-transferase YfcF
Synonym(s): YfcF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.326
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
6 -> 87 ITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLEDRFAPPT
13 -> 80 HFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLE
16 -> 16 S
10 -> 10 S
95 -> 214 DLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAKQSG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016034 - maleylacetoacetate isomerase activity
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0004364 - glutathione transferase activity
GO:0004601 - peroxidase activity
biological_process GO:0006749 - glutathione metabolic process
GO:0042542 - response to hydrogen peroxide
GO:0055114 - oxidation-reduction process
GO:0006559 - L-phenylalanine catabolic process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7193-MONOMER
ECOLIWIKI:
b2301
INTERPRO:
IPR034338
INTERPRO:
IPR040079
INTERPRO:
IPR036282
INTERPRO:
IPR036249
INTERPRO:
IPR010987
INTERPRO:
IPR004045
MODBASE:
P77544
PANTHER:
PTHR42673:SF6
PDB:
3BBY
PFAM:
PF02798
PFAM:
PF14834
PRIDE:
P77544
PROSITE:
PS50405
PROSITE:
PS50404
REFSEQ:
NP_416804
SMR:
P77544
UNIPROT:
P77544


Operon      
Name: yfcF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB