RegulonDB RegulonDB 8.6: Gene Form
   

yfcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcG yfcF folX TSS_2394 TSS_2394 TSS_2393 TSS_2393 TSS_2392 TSS_2392 TSS_2391 TSS_2391

Gene      
Name: yfcG    Texpresso search in the literature
Synonym(s): b2302
Genome position(nucleotides): 2418643 --> 2419290 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ECOCYC:
G7194
OU-MICROARRAY:
b2302
M3D: yfcG
COLOMBOS: yfcG
PortEco: b2302


Product      
Name: disulfide bond reductase
Synonym(s): GST N1-1, YfcG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 24.516
Isoelectric point: 6.97
Motif(s):
 
Type Positions Sequence
14 -> 14 K
166 -> 166 C
1 -> 87 MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAEKTGLFL
11 -> 11 N
9 -> 9 T

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0015036 - disulfide oxidoreductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
G7194-MONOMER
GENPROTEC:
b2302
PDB:
3GX0


Operon      
Name: yfcG         
Operon arrangement:
Transcription unit        Promoter
yfcG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2391 2419321 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2392 2419323 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2393 2419630 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2394 2419641 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB