RegulonDB RegulonDB 9.1: Gene Form
   

yfcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcG yfcF folX TSS_2617 TSS_2617 TSS_2616 TSS_2616 TSS_2615 TSS_2615 TSS_2614 TSS_2614

Gene      
Name: yfcG    Texpresso search in the literature
Synonym(s): b2302
Genome position(nucleotides): 2418643 --> 2419290 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ECOCYC:
G7194
GENBANK:
1788640
GENBANK_RefSeq:
16130237
OU-MICROARRAY:
b2302
M3D: yfcG
COLOMBOS: yfcG
PortEco: b2302


Product      
Name: disulfide bond reductase
Synonym(s): GST N1-1, YfcG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.516
Isoelectric point: 6.97
Motif(s):
 
Type Positions Sequence
14 -> 14 K
166 -> 166 C
1 -> 87 MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAEKTGLFL
4 -> 81 LYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAE
11 -> 11 N

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0015036 - disulfide oxidoreductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
G7194-MONOMER
GENPROTEC:
b2302
PDB:
3GX0


Operon      
Name: yfcG         
Operon arrangement:
Transcription unit        Promoter
yfcG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2614 2419321 forward nd nd nd
  promoter TSS_2615 2419323 forward nd nd nd
  promoter TSS_2616 2419630 forward nd nd nd
  promoter TSS_2617 2419641 forward nd nd nd



RegulonDB