RegulonDB RegulonDB 10.8: Gene Form
   

yfcH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcH rpnB folX TSS_2617 TSS_2617 TSS_2616 TSS_2616

Gene      
Name: yfcH    Texpresso search in the literature
Synonym(s): ECK2298, G7196, b2304
Genome position(nucleotides): 2421708 --> 2422601 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.92
External database links:  
ASAP:
ABE-0007605
ECHOBASE:
EB3864
OU-MICROARRAY:
b2304
PortEco:
yfcH
STRING:
511145.b2304
COLOMBOS: yfcH


Product      
Name: putative NAD-dependent epimerase YfcH
Synonym(s): YfcH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.699
Isoelectric point: 7.278
Motif(s):
 
Type Positions Sequence
249 -> 295 VPATAIRLLMGESSVLVLGGQRALPKRLEEAGFAFRWYDLEEALADV
3 -> 214 IVITGGTGLIGRHLIPRLLELGHQITVVTRNPQKASSVLGPRVTLWQGLADQSNLNGVDAVINLAGEPIADKRWTHEQKERLCQSRWNITQKLVDLINASDTPPSVLISGSATGYYGDLGEVVVTEEEPPHNEFTHKLCARWEEIACRAQSDKTRVCLLRTGVVLAPDGGILGKMLPPFRLGLGGPIGSGRQYLAWIHIDDMVNGILWLLDN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0050662 - coenzyme binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11981N
ECOCYC:
G7196-MONOMER
ECOLIWIKI:
b2304
INTERPRO:
IPR001509
INTERPRO:
IPR036291
INTERPRO:
IPR013549
INTERPRO:
IPR010099
MODBASE:
P77775
PANTHER:
PTHR11092
PFAM:
PF01370
PFAM:
PF08338
PRIDE:
P77775
REFSEQ:
NP_416807
SMR:
P77775
UNIPROT:
P77775


Operon      
Name: folX-yfcH         
Operon arrangement:
Transcription unit        Promoter
folX-yfcH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2616 2421608 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2617 2421619 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB