RegulonDB RegulonDB 10.8: Gene Form
   

rpnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcH rpnB hisP anti-anti-terminator anti-terminator terminator yfcIp7 yfcIp7 yfcIp8 yfcIp8

Gene      
Name: rpnB    Texpresso search in the literature
Synonym(s): ECK2299, G7197, b2305, yfcI
Genome position(nucleotides): 2422649 <-- 2423539 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.57
External database links:  
ASAP:
ABE-0007607
ECHOBASE:
EB3865
OU-MICROARRAY:
b2305
PortEco:
yfcI
STRING:
511145.b2305
COLOMBOS: rpnB


Product      
Name: recombination-promoting nuclease RpnB
Synonym(s): RpnB, YfcI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.179
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
8 -> 209 TPHDAVFKSFLRHPDTARDFIDIHLPAPLRKLCDLTTLKLEPNSFIDEDLRQYYSDLLWSVKTQEGVGYIYVVIEHQSKPEELMAFRMMRYSIAAMQNHLDAGYKELPLVLPMLFYHGCRSPYPYSLCWLDEFAEPAIARKIYSSAFPLVDITVVPDDEIMQHRKMALLELIQKHIRQRDLLGLVDQIVSLLVTGNTNDRQL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.4 - genetic exchange, recombination (for future)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:1990238 - double-stranded DNA endodeoxyribonuclease activity
biological_process GO:0006310 - DNA recombination
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kingston AW., et al., 2017
External database links:  
ECOCYC:
G7197-MONOMER
ECOLIWIKI:
b2305
INTERPRO:
IPR006842
INTERPRO:
IPR010106
PFAM:
PF04754
PRIDE:
P77768
REFSEQ:
NP_416808
UNIPROT:
P77768


Operon      
Name: rpnB         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcIp8 2423614 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfcIp7 2423712 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kingston AW., Ponkratz C., Raleigh EA., 2017, Rpn (YhgA-Like) Proteins of Escherichia coli K-12 and Their Contribution to RecA-Independent Horizontal Transfer., J Bacteriol 199(7)

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB