RegulonDB RegulonDB 10.8: Gene Form
   

mnmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mnmC fabB yfcL FadR FabR anti-anti-terminator fabBp fabBp TSS_2635 TSS_2635 TSS_2634 TSS_2634 TSS_2633 TSS_2633 TSS_2632 TSS_2632 TSS_2631 TSS_2631 TSS_2630 (cluster) TSS_2630 (cluster)

Gene      
Name: mnmC    Texpresso search in the literature
Synonym(s): ECK2318, G7199, b2324, trmC, yfcK
Genome position(nucleotides): 2441764 --> 2443770 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.86
External database links:  
ASAP:
ABE-0007681
ECHOBASE:
EB3867
OU-MICROARRAY:
b2324
PortEco:
mnmC
STRING:
511145.b2324
COLOMBOS: mnmC


Product      
Name: fused 5-methylaminomethyl-2-thiouridine-forming methyltransferase and FAD-dependent demodification enzyme
Synonym(s): MnmC, TrmC, YfcK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 74.434
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
270 -> 668 IGGGIASALLSLALLRRGWQVTLYCADEAPALGASGNRQGALYPLLSKHDEALNRFFSNAFTFARRFYDQLPVKFDHDWCGVTQLGWDEKSQHKIAQMLSMDLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAELTRNVLELAQQQGLQIYYQYQLQNLSRKDDCWLLNFAGDQQATHSVVVLANGHQISRFSQTSTLPVYSVAGQVSHIPTTPELAELKQVLCYDGYLTPQNPANQHHCIGASYHRGSEDTAYSEDDQQQNRQRLIDCFPQAQWAKEVDVSDKEARCGVRCATRDHLPMVGNVPDYEATLVEYASLAEQKDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILAAQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG
567 -> 567 R
118 -> 244 PELAPWAEQLQAQWPMPLPGCHRLLLDEGRVTLDLWFGDINELTSQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQDAGFTMQKRKGFGRKREMLCGVM
178 -> 178 D
1 -> 245 MKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDEGRVTLDLWFGDINELTSQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQDAGFTMQKRKGFGRKREMLCGVME

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0008757 - S-adenosylmethionine-dependent methyltransferase activity
GO:0004808 - tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity
GO:0016645 - oxidoreductase activity, acting on the CH-NH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0071949 - FAD binding
biological_process GO:0008152 - metabolic process
GO:0030488 - tRNA methylation
GO:0008033 - tRNA processing
GO:0032259 - methylation
GO:0055114 - oxidation-reduction process
GO:0002097 - tRNA wobble base modification
GO:0002098 - tRNA wobble uridine modification
Note(s): Note(s): ...[more].
Reference(s): [1] Bjork GR., et al., 1978
External database links:  
DIP:
DIP-28058N
ECOCYC:
G7199-MONOMER
ECOLIWIKI:
b2324
INTERPRO:
IPR017610
INTERPRO:
IPR036188
INTERPRO:
IPR023032
INTERPRO:
IPR008471
INTERPRO:
IPR006076
MODBASE:
P77182
PDB:
3AWI
PFAM:
PF01266
PFAM:
PF05430
PRIDE:
P77182
PRODB:
PRO_000023255
REFSEQ:
NP_416827
SMR:
P77182
UNIPROT:
P77182


Operon      
Name: mnmC         
Operon arrangement:
Transcription unit        Promoter
trmC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2630 (cluster) 2440572 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2631 2440574 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2632 2440576 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2633 2440845 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2634 2440847 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2635 2441152 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bjork GR., Kjellin-Straby K., 1978, General screening procedure for RNA modificationless mutants: isolation of Escherichia coli strains with specific defects in RNA methylation., J Bacteriol 133(2):499-507

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB