RegulonDB RegulonDB 10.8: Gene Form
   

yfcL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mnmC epmC yfcL TSS_2637 TSS_2637 yfcLp5 yfcLp5

Gene      
Name: yfcL    Texpresso search in the literature
Synonym(s): ECK2319, G7200, b2325
Genome position(nucleotides): 2443891 <-- 2444169 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.69
External database links:  
ASAP:
ABE-0007684
ECHOBASE:
EB3868
OU-MICROARRAY:
b2325
PortEco:
yfcL
STRING:
511145.b2325
COLOMBOS: yfcL


Product      
Name: PF08891 family protein YfcL
Synonym(s): YfcL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.0
Isoelectric point: 4.024
Motif(s):
 
Type Positions Sequence
4 -> 87 EFESRILALIDGMVDHASDDELFASGYLRGHLTLAIAELESGDDHSAQAVHTTVSQSLEKAIGAGELSPRDQALVTDMWENLFQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48102N
ECOCYC:
G7200-MONOMER
ECOLIWIKI:
b2325
INTERPRO:
IPR014987
PFAM:
PF08891
PRIDE:
P64540
REFSEQ:
NP_416828
UNIPROT:
P64540


Operon      
Name: prmB-aroC-mepA-yfcA-epmC-yfcL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcLp5 2444251 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2637 2444742 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB