RegulonDB RegulonDB 10.8: Gene Form
   

epmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mepA yfcA epmC yfcL TSS_2645 TSS_2645 TSS_2644 (cluster) TSS_2644 (cluster) TSS_2643 TSS_2643 TSS_2642 TSS_2642 TSS_2641 (cluster) TSS_2641 (cluster) TSS_2640 (cluster) TSS_2640 (cluster) TSS_2639 (cluster) TSS_2639 (cluster) TSS_2638 TSS_2638 TSS_2637 TSS_2637 yfcLp5 yfcLp5

Gene      
Name: epmC    Texpresso search in the literature
Synonym(s): ECK2320, G7201, b2326, yfcM
Genome position(nucleotides): 2444203 <-- 2444751 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.27
External database links:  
ASAP:
ABE-0007686
ECHOBASE:
EB3869
OU-MICROARRAY:
b2326
PortEco:
yfcM
STRING:
511145.b2326
COLOMBOS: epmC


Product      
Name: EF-P-Lys34 hydroxylase
Synonym(s): EpmC, YfcM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.146
Isoelectric point: 4.482
Motif(s):
 
Type Positions Sequence
13 -> 175 IFNSCFADDFNTRLIKGDDEPIYLPADAEVPYNRIVFAHGFYASAIHEISHWCIAGKARRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQALDWLFCVAAGYPFNVSCDNLEGDFEPDRVVFQRRVHAQVMDYLTNGIPERPARFIKALQNYYHTPELTAEQF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004497 - monooxygenase activity
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
biological_process GO:0043687 - post-translational protein modification
GO:0055114 - oxidation-reduction process
GO:1901260 - peptidyl-lysine hydroxylation involved in bacterial-type EF-P lysine modification
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11984N
ECOCYC:
G7201-MONOMER
ECOLIWIKI:
b2326
INTERPRO:
IPR007411
PDB:
4PDN
PFAM:
PF04315
PRIDE:
P76938
REFSEQ:
NP_416829
SMR:
P76938
UNIPROT:
P76938


Operon      
Name: prmB-aroC-mepA-yfcA-epmC-yfcL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcLp5 2444251 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2637 2444742 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2638 2444784 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2639 (cluster) 2444800 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2640 (cluster) 2444805 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2641 (cluster) 2444859 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2642 2444872 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2643 2444876 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2644 (cluster) 2444884 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2645 2445745 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB