RegulonDB RegulonDB 10.8: Gene Form
   

yfcO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcO smrB yfcP yfcQ TSS_2651 TSS_2651

Gene      
Name: yfcO    Texpresso search in the literature
Synonym(s): ECK2326, G7203, b2332
Genome position(nucleotides): 2449228 <-- 2450049 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.5
External database links:  
ASAP:
ABE-0007700
ECHOBASE:
EB3871
OU-MICROARRAY:
b2332
PortEco:
yfcO
STRING:
511145.b2332
COLOMBOS: yfcO


Product      
Name: DUF2544 domain-containing protein YfcO
Synonym(s): YfcO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.26
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
1 -> 21 MKILRWLFALVMLIATTEAMA
44 -> 273 LKIMMPSAVYVGEYKSSQWLMTGEILQNVSWSGPPPAPSVKLIGYHQNINKASCPGLPSGWNCGYYTFEVIVSAEIESYFSCPWLVIMNDSEASPGGVTYQGPDSHDTICPSVSVQPYDVSWNENYVSKSKLLTLQSTGGVVEKTLSTYLMKDGKLCDSTQMNETGGYCRWVAQMITFTASGCDKAEVSVTPNRHPITDKQLHDMVVRVDTSSMQPIDSTCRFQYILNEL
22 -> 273 AGHSVDVYYGYNGDSRNIATFNLKIMMPSAVYVGEYKSSQWLMTGEILQNVSWSGPPPAPSVKLIGYHQNINKASCPGLPSGWNCGYYTFEVIVSAEIESYFSCPWLVIMNDSEASPGGVTYQGPDSHDTICPSVSVQPYDVSWNENYVSKSKLLTLQSTGGVVEKTLSTYLMKDGKLCDSTQMNETGGYCRWVAQMITFTASGCDKAEVSVTPNRHPITDKQLHDMVVRVDTSSMQPIDSTCRFQYILNEL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [ICWHO] Inferred computationally without human oversight
Reference(s): [1] Korea CG., et al., 2011
[2] Wurpel DJ., et al., 2013
[3] Zhai Y., et al., 2002
External database links:  
ECOCYC:
G7203-MONOMER
ECOLIWIKI:
b2332
INTERPRO:
IPR021407
PFAM:
PF11245
PRIDE:
P76498
REFSEQ:
NP_416835
UNIPROT:
P76498


Operon      
Name: yfcUSRQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2651 2449437 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [2] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [3] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB