RegulonDB RegulonDB 10.8: Gene Form
   

yfcP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcO yfcP yfcR yfcQ TSS_2651 TSS_2651

Gene      
Name: yfcP    Texpresso search in the literature
Synonym(s): ECK2327, G7204, b2333
Genome position(nucleotides): 2450051 <-- 2450590 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.7
External database links:  
ASAP:
ABE-0007702
ECHOBASE:
EB3872
OU-MICROARRAY:
b2333
PortEco:
yfcP
STRING:
511145.b2333
COLOMBOS: yfcP


Product      
Name: putative fimbrial protein YfcP
Synonym(s): YfcP
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.951
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
28 -> 179 ADNNLHFSGNLLSKSCALVVDGQYLAEVRFPTVSRQDLNVAGQSARVPVVFKLKDCKGPAGYNVKVTLTGVEDSEQPGFLALDTSSTAQGVGIGMEKTDGMQVAINNTNGATFALTNGNNDINFRAWLQAKSGRDVTIGEFTASLTATFEYI
1 -> 27 MNKSMIQSGGYVLLAGLILAMSSTLFA
33 -> 178 HFSGNLLSKSCALVVDGQYLAEVRFPTVSRQDLNVAGQSARVPVVFKLKDCKGPAGYNVKVTLTGVEDSEQPGFLALDTSSTAQGVGIGMEKTDGMQVAINNTNGATFALTNGNNDINFRAWLQAKSGRDVTIGEFTASLTATFEY

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G7204-MONOMER
ECOLIWIKI:
b2333
INTERPRO:
IPR000259
INTERPRO:
IPR036937
INTERPRO:
IPR008966
MODBASE:
P76499
PFAM:
PF00419
PRIDE:
P76499
REFSEQ:
NP_416836
SMR:
P76499
UNIPROT:
P76499


Operon      
Name: yfcUSRQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2651 2449437 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB