RegulonDB RegulonDB 10.8: Gene Form
   

yfcR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcU yfcS yfcP yfcR yfcQ

Gene      
Name: yfcR    Texpresso search in the literature
Synonym(s): ECK2329, G7206, b2335
Genome position(nucleotides): 2451072 <-- 2451584 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.12
External database links:  
ASAP:
ABE-0007707
ECHOBASE:
EB3874
OU-MICROARRAY:
b2335
PortEco:
yfcR
STRING:
511145.b2335
COLOMBOS: yfcR


Product      
Name: putative fimbrial protein YfcR
Synonym(s): YfcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 17.89
Isoelectric point: 4.736
Motif(s):
 
Type Positions Sequence
1 -> 28 MTGGVMSQKFVVGAGLLVCSVCSLSAMA
29 -> 170 GSKPVDLILRVLVDAPPPCSIKGSQVEFGNMIADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSADNSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ
43 -> 170 APPPCSIKGSQVEFGNMIADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSADNSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Paradis-Bleau C., et al., 2014
[4] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G7206-MONOMER
ECOLIWIKI:
b2335
INTERPRO:
IPR000259
INTERPRO:
IPR036937
INTERPRO:
IPR008966
MODBASE:
P76501
PFAM:
PF00419
PRIDE:
P76501
REFSEQ:
NP_416838
SMR:
P76501
UNIPROT:
P76501


Operon      
Name: yfcUSRQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB