RegulonDB RegulonDB 11.0: Gene Form
   

yfcR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcU yfcS yfcP yfcR yfcQ

Gene      
Name: yfcR    Texpresso search in the literature
Synonym(s): ECK2329, G7206, b2335
Genome position(nucleotides): 2451072 <-- 2451584
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.12
External database links:  
ASAP:
ABE-0007707
ECHOBASE:
EB3874
ECOLIHUB:
yfcR
OU-MICROARRAY:
b2335
STRING:
511145.b2335
COLOMBOS: yfcR


Product      
Name: putative fimbrial protein YfcR
Synonym(s): YfcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 17.89
Isoelectric point: 4.736
Motif(s):
 
Type Positions Sequence Comment
1 -> 28 MTGGVMSQKFVVGAGLLVCSVCSLSAMA
29 -> 170 GSKPVDLILRVLVDAPPPCSIKGSQVEFGNMIADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSADNSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ UniProt: Uncharacterized fimbrial-like protein YfcR.
43 -> 170 APPPCSIKGSQVEFGNMIADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSADNSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Paradis-Bleau C., et al., 2014
[4] Wurpel DJ., et al., 2013
External database links:  
ALPHAFOLD:
P76501
ECOCYC:
G7206-MONOMER
ECOLIWIKI:
b2335
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P76501
PFAM:
PF00419
PRIDE:
P76501
REFSEQ:
NP_416838
SMR:
P76501
UNIPROT:
P76501


Operon      
Name: yfcUSRQPO         
Operon arrangement:
Transcription unit        Promoter
yfcUSRQPO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB