RegulonDB RegulonDB 10.8: Gene Form
   

yfcS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcU yfcS yfcV yfcR yfcQ yfcP

Gene      
Name: yfcS    Texpresso search in the literature
Synonym(s): ECK2330, G7207, b2336
Genome position(nucleotides): 2451584 <-- 2452336 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
ASAP:
ABE-0007709
ECHOBASE:
EB3875
OU-MICROARRAY:
b2336
PortEco:
yfcS
STRING:
511145.b2336
COLOMBOS: yfcS


Product      
Name: putative fimbrial chaperone YfcS
Synonym(s): YfcS
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 27.728
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
30 -> 147 VTPDRTRLIFNESDKSISVTLRNNDPKLPYLAQSWIEDEKGNKITSPLTVLPPVQRIDSMMNGQVKVQGMPDINKLPADRESMFYFNVREIPPKSNKPNTLQIALQTRIKLFWRPKAL
171 -> 228 VNNPTPYYVIISNASAQKNGNPAAGFSPLVIEPKTTVPLNVKMDSVPVLTYVNDFGAR
1 -> 28 MSDLLCSAKLGAMTLALLLSATSLSALA
29 -> 250 SVTPDRTRLIFNESDKSISVTLRNNDPKLPYLAQSWIEDEKGNKITSPLTVLPPVQRIDSMMNGQVKVQGMPDINKLPADRESMFYFNVREIPPKSNKPNTLQIALQTRIKLFWRPKALEKVSMKSPWQHKVTLTRSGQAFTVNNPTPYYVIISNASAQKNGNPAAGFSPLVIEPKTTVPLNVKMDSVPVLTYVNDFGARMPLFFQCNGNSCQVDEEQSRKG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006457 - protein folding
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
[4] Zhai Y., et al., 2002
External database links:  
ECOCYC:
G7207-MONOMER
ECOLIWIKI:
b2336
INTERPRO:
IPR013783
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016148
INTERPRO:
IPR016147
INTERPRO:
IPR008962
INTERPRO:
IPR001829
MODBASE:
P77599
PFAM:
PF02753
PFAM:
PF00345
PRIDE:
P77599
PRINTS:
PR00969
PROSITE:
PS00635
REFSEQ:
NP_416839
SMR:
P77599
SWISSMODEL:
P77599
UNIPROT:
P77599


Operon      
Name: yfcUSRQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207


RegulonDB