RegulonDB RegulonDB 10.8: Gene Form
   

yfcV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcU yfcS yfcV sixA yfcVp6 yfcVp6 yfcVp8 yfcVp8 yfcVp7 yfcVp7 yfcVp9 yfcVp9

Gene      
Name: yfcV    Texpresso search in the literature
Synonym(s): ECK2333, G7210, b2339
Genome position(nucleotides): 2455083 <-- 2455646 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.1
External database links:  
ASAP:
ABE-0007715
ECHOBASE:
EB3877
OU-MICROARRAY:
b2339
PortEco:
yfcV
STRING:
511145.b2339
COLOMBOS: yfcV


Product      
Name: putative fimbrial protein YfcV
Synonym(s): YfcV
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 19.851
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
1 -> 25 MSKFVKTAIAAAMVMGAFTSTATIA
34 -> 186 FYGTIEDSVCSIVPDDHKLEVDMGDIGAEKLKNNGTTTPKNFQIRLQDCVFDTQETMTTTFTGTVSSANSGNYYTIFNTDTGAAFNNVSLAIGDSLGTSYKSGMGIDQKIVKDTATNKGKAKQTLNFKAWLVGAADAPDLGNFEANTTFQITY
26 -> 187 AGNNGTARFYGTIEDSVCSIVPDDHKLEVDMGDIGAEKLKNNGTTTPKNFQIRLQDCVFDTQETMTTTFTGTVSSANSGNYYTIFNTDTGAAFNNVSLAIGDSLGTSYKSGMGIDQKIVKDTATNKGKAKQTLNFKAWLVGAADAPDLGNFEANTTFQITYL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G7210-MONOMER
ECOLIWIKI:
b2339
INTERPRO:
IPR000259
INTERPRO:
IPR036937
INTERPRO:
IPR008966
MODBASE:
P77288
PFAM:
PF00419
PRIDE:
P77288
REFSEQ:
NP_416841
SMR:
P77288
UNIPROT:
P77288


Operon      
Name: yfcV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcVp9 2455654 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfcVp7 2455668 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfcVp8 2455688 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfcVp6 2455821 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB