RegulonDB RegulonDB 10.8: Gene Form
   

sixA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadJ yfcV sixA sixAp sixAp TSS_2652 TSS_2652 yfcVp6 yfcVp6 yfcVp8 yfcVp8 yfcVp7 yfcVp7 yfcVp9 yfcVp9

Gene      
Name: sixA    Texpresso search in the literature
Synonym(s): ECK2334, G7211, b2340, yfcW
Genome position(nucleotides): 2456327 <-- 2456812 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.29
External database links:  
ASAP:
ABE-0007720
ECHOBASE:
EB3878
OU-MICROARRAY:
b2340
PortEco:
sixA
STRING:
511145.b2340
COLOMBOS: sixA


Product      
Name: phosphohistidine phosphatase SixA
Synonym(s): SixA, YfcW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.208
Isoelectric point: 4.19
Motif(s):
 
Type Positions Sequence
80 -> 80 T
3 -> 71 VFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0101006 - protein histidine phosphatase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0016791 - phosphatase activity
biological_process GO:0035971 - peptidyl-histidine dephosphorylation
GO:0006464 - cellular protein modification process
GO:0070297 - regulation of phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Reference(s): [1] Matsubara M., et al., 1999
[2] Matsubara M., et al., 2000
External database links:  
DIP:
DIP-10885N
ECOCYC:
G7211-MONOMER
ECOLIWIKI:
b2340
INTERPRO:
IPR004449
INTERPRO:
IPR029033
INTERPRO:
IPR013078
MODBASE:
P76502
PDB:
1UJB
PDB:
1UJC
PFAM:
PF00300
PRIDE:
P76502
PRODB:
PRO_000023952
REFSEQ:
NP_416842
SMART:
SM00855
SMR:
P76502
UNIPROT:
P76502


Operon      
Name: sixA         
Operon arrangement:
Transcription unit        Promoter
sixA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfcVp9 2455654 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yfcVp7 2455668 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yfcVp8 2455688 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yfcVp6 2455821 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2652 2456916 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Matsubara M., Mizuno T., 1999, EnvZ-independent phosphotransfer signaling pathway of the OmpR-mediated osmoregulatory expression of OmpC and OmpF in Escherichia coli., Biosci Biotechnol Biochem 63(2):408-14

 [2] Matsubara M., Mizuno T., 2000, The SixA phospho-histidine phosphatase modulates the ArcB phosphorelay signal transduction in Escherichia coli., FEBS Lett 470(2):118-24

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB