RegulonDB RegulonDB 10.8: Gene Form
   

fadI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadJ fadI sixA yfcZ ArcA FadR anti-anti-terminator anti-terminator terminator fadIp fadIp sixAp sixAp TSS_2652 TSS_2652

Gene      
Name: fadI    Texpresso search in the literature
Synonym(s): ECK2336, G7213, b2342, yfcY
Genome position(nucleotides): 2459159 <-- 2460469 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.84
External database links:  
ASAP:
ABE-0007725
ECHOBASE:
EB3880
MIM:
609015
OU-MICROARRAY:
b2342
PortEco:
fadI
STRING:
511145.b2342
COLOMBOS: fadI


Product      
Name: 3-ketoacyl-CoA thiolase FadI
Synonym(s): FadI, FadI component of anaerobic fatty acid oxidation complex, YfcY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.531
Isoelectric point: 8.653
Motif(s):
 
Type Positions Sequence
297 -> 434 PLGYLRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSERFAREALGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVTACAAGGLGAAMVLE
15 -> 288 IAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPAEVIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKKLARVLVDVNKARTMSQRLKLFSRLRLRDLMPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVEDNNIRGNSSLADYAKLRPAFDRKHGTVTAANSTPLTDGAAAVILMTES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0003985 - acetyl-CoA C-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase activity
GO:0003988 - acetyl-CoA C-acyltransferase activity
GO:0004300 - enoyl-CoA hydratase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0016042 - lipid catabolic process
GO:0006635 - fatty acid beta-oxidation
GO:0033542 - fatty acid beta-oxidation, unsaturated, even number
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11991N
ECOCYC:
G7213-MONOMER
ECOLIWIKI:
b2342
INTERPRO:
IPR020610
INTERPRO:
IPR020617
INTERPRO:
IPR020616
INTERPRO:
IPR020615
INTERPRO:
IPR020613
INTERPRO:
IPR016039
INTERPRO:
IPR012806
INTERPRO:
IPR002155
MODBASE:
P76503
PANTHER:
PTHR18919:SF113
PFAM:
PF02803
PFAM:
PF00108
PRIDE:
P76503
PROSITE:
PS00737
PROSITE:
PS00099
PROSITE:
PS00098
REFSEQ:
NP_416844
SMR:
P76503
SWISSMODEL:
P76503
UNIPROT:
P76503


Operon      
Name: fadIJ         
Operon arrangement:
Transcription unit        Promoter
fadIJ


Transcriptional Regulation      
Display Regulation             
Repressed by: FadR, ArcA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2652 2456916 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB