RegulonDB RegulonDB 10.7: Gene Form
   

yfcZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadL fadI yfcZ OmpR OmpR FadR FadR ArcA OmpR OmpR CRP PhoP ArcA FadR ppGpp anti-anti-terminator anti-terminator terminator fadLp fadLp yfcZp yfcZp TSS_2653 TSS_2653 fadIp fadIp

Gene      
Name: yfcZ    Texpresso search in the literature
Synonym(s): ECK2337, G7214, b2343
Genome position(nucleotides): 2460650 <-- 2460934 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0007731
ECHOBASE:
EB3881
OU-MICROARRAY:
b2343
PORTECO:
yfcZ
REGULONDB:
b2343
STRING:
511145.b2343
M3D: yfcZ
COLOMBOS: yfcZ
PortEco: b2343


Product      
Name: DUF406 domain-containing protein YfcZ
Synonym(s): YfcZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.318
Isoelectric point: 3.999
Motif(s):
 
Type Positions Sequence
3 -> 94 KCSADETPVCCCMDVGTIMDNSDCTASYSRVFANRAEAEQTLAALTEKARSVESEPCKITPTFTEESDGVRLDIDFTFACEAEMLIFQLGLR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47925N
ECOCYC:
G7214-MONOMER
ECOLIWIKI:
b2343
INTERPRO:
IPR005272
INTERPRO:
IPR035571
PANTHER:
PTHR38769
PFAM:
PF04175
PRIDE:
P0AD33
PROTEINMODELPORTAL:
P0AD33
REFSEQ:
NP_416845
SMR:
P0AD33
UNIPROT:
P0AD33


Operon      
Name: yfcZ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2653 2460973 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB