RegulonDB RegulonDB 10.7: Gene Form
   

intS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intS yfdG argW yfdH terminator TSS_2656 TSS_2656 TSS_2655 TSS_2655 yfdGp4 yfdGp4 intSp intSp intSp5 intSp5

Gene      
Name: intS    Texpresso search in the literature
Synonym(s): ECK2343, G7218, b2349, intC, yfdB
Genome position(nucleotides): 2466545 --> 2467702 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.75
External database links:  
ASAP:
ABE-0007756
ECHOBASE:
EB2312
OU-MICROARRAY:
b2349
PORTECO:
intS
REGULONDB:
b2349
STRING:
511145.b2349
M3D: intS
COLOMBOS: intS
PortEco: b2349


Product      
Name: CPS-53 (KpLE1) prophage; prophage CPS-53 integrase
Synonym(s): IntC, IntS, YfdB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.061
Isoelectric point: 9.911
Motif(s):
 
Type Positions Sequence
2 -> 86 LTVKQIEAAKPKEKPYRLLDGNGLYLYVPVSGKKVWQLRYKIDGKEKILTVGKYPLMTLQEARDKAWTARKDISVGIDPVKAKKA
93 -> 141 FSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQL
199 -> 364 FLPADQIPAFNKALATFSGSIVSLIATKVLRYTALRTKELRSMLWKNVDFENRIITIDASVMKGRKIHVVPMSDQVVELLTTLSSITKPVSEFVFAGRNDKKKPICENAVLLVIKQIGYEGLESGHGFRHEFSTIMNEHEWPADAIEVQLAHANGGSVRGIYNHAQ
195 -> 373 KNFPFLPADQIPAFNKALATFSGSIVSLIATKVLRYTALRTKELRSMLWKNVDFENRIITIDASVMKGRKIHVVPMSDQVVELLTTLSSITKPVSEFVFAGRNDKKKPICENAVLLVIKQIGYEGLESGHGFRHEFSTIMNEHEWPADAIEVQLAHANGGSVRGIYNHAQYLDKRREMM

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0032359 - provirus excision
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Panis G., et al., 2007
External database links:  
DIP:
DIP-10041N
ECOCYC:
G7218-MONOMER
ECOLIWIKI:
b2349
INTERPRO:
IPR004107
INTERPRO:
IPR002104
INTERPRO:
IPR010998
INTERPRO:
IPR011010
INTERPRO:
IPR013762
INTERPRO:
IPR025166
INTERPRO:
IPR038488
MODBASE:
P37326
PDB:
2KJ8
PFAM:
PF13356
PFAM:
PF00589
PFAM:
PF14659
PRIDE:
P37326
PROSITE:
PS51898
PROTEINMODELPORTAL:
P37326
REFSEQ:
NP_416850
SMR:
P37326
UNIPROT:
P37326


Operon      
Name: intS         
Operon arrangement:
Transcription unit        Promoter
intS


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter intSp5 2466513 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfdGp4 2467737 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2655 2467830 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2656 2468210 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Panis G., Mejean V., Ansaldi M., 2007, Control and regulation of KplE1 prophage site-specific recombination: a new recombination module analyzed., J Biol Chem 282(30):21798-809

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB