RegulonDB RegulonDB 10.7: Gene Form
   

yfdG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdI intS yfdH yfdG TSS_2657 TSS_2657 TSS_2656 TSS_2656 TSS_2655 TSS_2655 yfdGp4 yfdGp4

Gene      
Name: yfdG    Texpresso search in the literature
Synonym(s): ECK2344, G7219, b2350, gtrA
Genome position(nucleotides): 2467855 --> 2468217 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.01
External database links:  
ASAP:
ABE-0007761
ECHOBASE:
EB3883
OU-MICROARRAY:
b2350
PORTECO:
yfdG
REGULONDB:
b2350
STRING:
511145.b2350
M3D: yfdG
COLOMBOS: yfdG
PortEco: b2350


Product      
Name: CPS-53 (KpLE1) prophage; putative bactoprenol-linked glucose translocase
Synonym(s): GtrA, YfdG, gtrAEC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.226
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
34 -> 54 QALANFAGFVVAVSFSFFANA
7 -> 116 KYTSIGVLNTLIHWVVFGVCIYVAHTNQALANFAGFVVAVSFSFFANAKFTFKASTTTMRYMLYVGFMGTLSATVGWAADRCALPPMITLVTFSAISLVCGFVYSKFIVF
89 -> 109 ALPPMITLVTFSAISLVCGFV
10 -> 30 SIGVLNTLIHWVVFGVCIYVA
65 -> 85 MRYMLYVGFMGTLSATVGWAA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0008883 - glutamyl-tRNA reductase activity
GO:0050661 - NADP binding
GO:0003870 - 5-aminolevulinate synthase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0006783 - heme biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Adams MM., et al., 2001
External database links:  
ECOCYC:
G7219-MONOMER
ECOLIWIKI:
b2350
INTERPRO:
IPR007267
INTERPRO:
IPR016480
PFAM:
PF04138
PRIDE:
P77682
PROTEINMODELPORTAL:
P77682
REFSEQ:
NP_416851
SMR:
P77682
UNIPROT:
P77682


Operon      
Name: yfdGHI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfdGp4 2467737 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2655 2467830 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2656 2468210 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2657 2468808 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adams MM., Allison GE., Verma NK., 2001, Type IV O antigen modification genes in the genome of Shigella flexneri NCTC 8296., Microbiology 147(Pt 4):851-60

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB