RegulonDB RegulonDB 10.7: Gene Form
   

yfdK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdL yfdK tfaS yfdM ryeG yodE terminator anti-terminator anti-anti-terminator TSS_2661 TSS_2661 TSS_2660 TSS_2660 TSS_2659 (cluster) TSS_2659 (cluster) TSS_2658 TSS_2658

Gene      
Name: yfdK    Texpresso search in the literature
Synonym(s): ECK2348, G7223, b2354
Genome position(nucleotides): 2471077 <-- 2471517 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.58
External database links:  
ASAP:
ABE-0007770
ECHOBASE:
EB3887
OU-MICROARRAY:
b2354
PORTECO:
yfdK
REGULONDB:
b2354
STRING:
511145.b2354
M3D: yfdK
COLOMBOS: yfdK
PortEco: b2354


Product      
Name: CPS-53 (KpLE1) prophage; putative tail fiber assembly protein YfdK
Synonym(s): YfdK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.408
Isoelectric point: 4.075
Motif(s):
 
Type Positions Sequence
8 -> 141 TTNSFYPLEMKEDYTQAGSWPDDAVEVDEQVYIEFSGLPPKGKIRIAGENGFPAWSEIPPPTHEEQIAAAELKKQQLINQANDYMNSKQWAGKAAIGRLKGEELAQYNLWLDYLDALELVDTSSAPDIEWPTPP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
biological_process GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11999N
ECOCYC:
G7223-MONOMER
ECOLIWIKI:
b2354
INTERPRO:
IPR003458
PFAM:
PF02413
PRIDE:
P77656
PROTEINMODELPORTAL:
P77656
REFSEQ:
NP_416855
SMR:
P77656
UNIPROT:
P77656


Operon      
Name: yfdONMLK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2658 2470649 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2659 (cluster) 2470665 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2660 2470691 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2661 2470748 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB