RegulonDB RegulonDB 10.7: Gene Form
   

yfdN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdL yfdN yfdO yfdP yfdM terminator anti-terminator anti-anti-terminator yfdPp9 yfdPp9 yfdPp6 yfdPp6 yfdPp5 yfdPp5

Gene      
Name: yfdN    Texpresso search in the literature
Synonym(s): ECK2351, G7226, b2357, yzyA
Genome position(nucleotides): 2472387 <-- 2472881 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.34
External database links:  
ASAP:
ABE-0007777
ECHOBASE:
EB2783
OU-MICROARRAY:
b2357
PORTECO:
yfdN
REGULONDB:
b2357
STRING:
511145.b2357
M3D: yfdN
COLOMBOS: yfdN
PortEco: b2357


Product      
Name: CPS-53 (KpLE1) prophage; protein YzyA
Synonym(s): YfdN, YzyA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.766
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
100 -> 151 RQAEELESRGLYRRAATVWMAAFRESHSQPERNNFLARRERCLRKSSKRAAS
73 -> 73 P

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7226-MONOMER
ECOLIWIKI:
b2357
INTERPRO:
IPR024684
PFAM:
PF06069
PRIDE:
P76510
PRODOM:
PD096295
PROTEINMODELPORTAL:
P76510
REFSEQ:
NP_416858
SMR:
P76510
UNIPROT:
P76510


Operon      
Name: yfdONMLK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfdPp5 2473422 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfdPp6 2473536 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfdPp9 2473572 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB