RegulonDB RegulonDB 10.7: Gene Form
   

yfdE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

evgS yfdE yfdV anti-terminator terminator TSS_2669 TSS_2669

Gene      
Name: yfdE    Texpresso search in the literature
Synonym(s): ECK2367, G7234, b2371
Genome position(nucleotides): 2488023 <-- 2489168 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.46
External database links:  
ASAP:
ABE-0007821
ECHOBASE:
EB3069
MIM:
231690
OU-MICROARRAY:
b2371
PORTECO:
yfdE
REGULONDB:
b2371
STRING:
511145.b2371
M3D: yfdE
COLOMBOS: yfdE
PortEco: b2371


Product      
Name: acetyl-CoA:oxalate CoA-transferase
Synonym(s): YfdE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.671
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
368 -> 368 L
11 -> 363 EGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEINPRLIYASSSGFGHTGPLKDAPAYDTIIQAMSGIMMETGYPDAPPVRVGTSLADLCGGVYLFSGIVSALYGREKSQRGAHVDIAMFDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFDVFNTQDKPITICCGNDKLFSALCQALELTELVNDPRFSSNILRVQNQAILKQYIERTLKTQAAEVWLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLIEAGGIMMPGNPIKISGCADPHVMP
333 -> 333 Q
357 -> 357 A
294 -> 294 I

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008410 - CoA-transferase activity
GO:0042803 - protein homodimerization activity
GO:0036412 - acetyl-CoA:oxalate CoA-transferase
External database links:  
DIP:
DIP-11994N
ECOCYC:
G7234-MONOMER
ECOLIWIKI:
b2371
INTERPRO:
IPR003673
INTERPRO:
IPR023606
MINT:
MINT-1289026
MODBASE:
P76518
PANTHER:
PTHR43949
PDB:
4HL6
PFAM:
PF02515
PRIDE:
P76518
PROTEINMODELPORTAL:
P76518
REFSEQ:
NP_416872
SMR:
P76518
SWISSMODEL:
P76518
UNIPROT:
P76518


Operon      
Name: yfdX-frc-oxc-yfdVE         
Operon arrangement:
Transcription unit        Promoter
frc
yfdX
 


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2669 2485186 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB