RegulonDB RegulonDB 10.7: Gene Form
   

oxc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oxc frc yfdV anti-terminator terminator terminator oxcp11 oxcp11 oxcp10 oxcp10

Gene      
Name: oxc    Texpresso search in the literature
Synonym(s): ECK2369, G7236, b2373, yfdU
Genome position(nucleotides): 2490256 <-- 2491950 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.61
External database links:  
ASAP:
ABE-0007826
ECHOBASE:
EB3895
OU-MICROARRAY:
b2373
PORTECO:
oxc
REGULONDB:
b2373
STRING:
511145.b2373
M3D: oxc
COLOMBOS: oxc
PortEco: b2373


Product      
Name: oxalyl-CoA decarboxylase
Synonym(s): Oxc, YfdU
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.581
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
402 -> 540 ARNIIDMYKPRRRLDCGTWGVMGIGMGYAIGASVTSGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNGGIYRGDGVDLSGAGAPSPTDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINV
421 -> 423 GVM
550 -> 552 SGH
396 -> 398 ANT
261 -> 265 AAARS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016830 - carbon-carbon lyase activity
GO:0016831 - carboxy-lyase activity
GO:0000166 - nucleotide binding
GO:0000287 - magnesium ion binding
GO:0008949 - oxalyl-CoA decarboxylase activity
GO:0030976 - thiamine pyrophosphate binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
biological_process GO:0001561 - fatty acid alpha-oxidation
GO:0033611 - oxalate catabolic process
GO:0071468 - cellular response to acidic pH
External database links:  
DIP:
DIP-48075N
ECOCYC:
G7236-MONOMER
ECOLIWIKI:
b2373
INTERPRO:
IPR029035
INTERPRO:
IPR017660
INTERPRO:
IPR012001
INTERPRO:
IPR029061
INTERPRO:
IPR011766
INTERPRO:
IPR012000
MINT:
P0AFI0
MODBASE:
P0AFI0
PDB:
2Q29
PDB:
2Q28
PDB:
2Q27
PFAM:
PF00205
PFAM:
PF02776
PFAM:
PF02775
PRIDE:
P0AFI0
PROSITE:
PS00187
PROTEINMODELPORTAL:
P0AFI0
REFSEQ:
NP_416874
SMR:
P0AFI0
SWISSMODEL:
P0AFI0
UNIPROT:
P0AFI0


Operon      
Name: yfdX-frc-oxc-yfdVE         
Operon arrangement:
Transcription unit        Promoter
frc
yfdX
 


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter oxcp10 2492130 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter oxcp11 2492144 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB