RegulonDB RegulonDB 10.7: Gene Form
   

yfdY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpxP tpke70 ypdI yfdY terminator lpxPp lpxPp TSS_2670 TSS_2670 yfdYp6 yfdYp6 yfdYp5 yfdYp5

Gene      
Name: yfdY    Texpresso search in the literature
Synonym(s): ECK2373, G7240, b2377
Genome position(nucleotides): 2495050 <-- 2495292 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0007841
ECHOBASE:
EB3899
OU-MICROARRAY:
b2377
PORTECO:
yfdY
REGULONDB:
b2377
M3D: yfdY
COLOMBOS: yfdY
PortEco: b2377


Product      
Name: DUF2545 domain-containing protein YfdY
Synonym(s): YfdY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.874
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
55 -> 75 LVTGIFMFLAPACGLMIRFMV
2 -> 22 INLWMFLALCIVCVSGYIGQV
32 -> 52 FFGMVILAALIYYFTMWLTGG
1 -> 80 MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIFMFLAPACGLMIRFMVGYGRR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7240-MONOMER
ECOLIWIKI:
b2377
INTERPRO:
IPR024470
PFAM:
PF10810
PRIDE:
P76521
PRODOM:
PD857460
PROTEINMODELPORTAL:
P76521
REFSEQ:
NP_416878
UNIPROT:
P76521


Operon      
Name: yfdY         
Operon arrangement:
Transcription unit        Promoter
yfdY


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfdYp5 2495333 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfdYp6 2495336 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2670 2495493 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB