RegulonDB RegulonDB 10.7: Gene Form
   

lpxP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpxP tpke70 yfdY ypdK terminator lpxPp lpxPp TSS_2670 TSS_2670 yfdYp6 yfdYp6 yfdYp5 yfdYp5

Gene      
Name: lpxP    Texpresso search in the literature
Synonym(s): ECK2374, G7241, b2378, ddg
Genome position(nucleotides): 2495645 --> 2496565 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.47
External database links:  
ASAP:
ABE-0007848
ECHOBASE:
EB2738
OU-MICROARRAY:
b2378
PORTECO:
lpxP
REGULONDB:
b2378
STRING:
511145.b2378
M3D: lpxP
COLOMBOS: lpxP
PortEco: b2378


Product      
Name: palmitoleoyl acyltransferase
Synonym(s): Ddg, LpxP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 35.493
Isoelectric point: 10.277
Motif(s):
 
Type Positions Sequence
20 -> 40 WFGLGVLWLWVQLPYPVLCFL
5 -> 296 CKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLKRRESIARKNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNLKRAQMQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAMIGRNNLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVTMVRKADYSGYRLFITPEMEGYPTDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKT
132 -> 137 HFMSLE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008951 - palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0009409 - response to cold
GO:0036104 - Kdo2-lipid A biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Opiyo SO., et al., 2010
External database links:  
ECOCYC:
PALMITOTRANS-MONOMER
ECOLIWIKI:
b2378
INTERPRO:
IPR004960
INTERPRO:
IPR011920
INTERPRO:
IPR030857
PANTHER:
PTHR30606
PFAM:
PF03279
PRIDE:
P0ACV2
PRODB:
PRO_000022418
PROTEINMODELPORTAL:
P0ACV2
REFSEQ:
NP_416879
SMR:
P0ACV2
UNIPROT:
P0ACV2


Operon      
Name: lpxP         
Operon arrangement:
Transcription unit        Promoter
lpxP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfdYp5 2495333 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfdYp6 2495336 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2670 2495493 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Opiyo SO., Pardy RL., Moriyama H., Moriyama EN., 2010, Evolution of the Kdo2-lipid A biosynthesis in bacteria., BMC Evol Biol 10:362

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB