RegulonDB RegulonDB 10.8: Gene Form
   

alaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrS alaC ypdK SgrR terminator alaCp alaCp TSS_2671 TSS_2671

Gene      
Name: alaC    Texpresso search in the literature
Synonym(s): ECK2375, G7242, b2379, yfdZ
Genome position(nucleotides): 2497057 <-- 2498295 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.96
External database links:  
ASAP:
ABE-0007850
ECHOBASE:
EB3950
OU-MICROARRAY:
b2379
PortEco:
yfdZ
STRING:
511145.b2379
COLOMBOS: alaC


Product      
Name: glutamate—pyruvate aminotransferase AlaC
Synonym(s): AlaC, YfdZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.216
Isoelectric point: 8.009
Motif(s):
 
Type Positions Sequence
37 -> 376 DIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.17 - alanine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004021 - L-alanine:2-oxoglutarate aminotransferase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006523 - alanine biosynthetic process
GO:0009058 - biosynthetic process
GO:0019272 - L-alanine biosynthetic process from pyruvate
GO:0030632 - D-alanine biosynthetic process
External database links:  
DIP:
DIP-12010N
ECOCYC:
G7242-MONOMER
ECOLIWIKI:
b2379
INTERPRO:
IPR015422
INTERPRO:
IPR015424
INTERPRO:
IPR015421
INTERPRO:
IPR004839
MODBASE:
P77434
PFAM:
PF00155
PRIDE:
P77434
PROSITE:
PS00105
REFSEQ:
NP_416880
SMR:
P77434
UNIPROT:
P77434


Operon      
Name: alaC         
Operon arrangement:
Transcription unit        Promoter
alaC


Transcriptional Regulation      
Display Regulation             
Activated by: SgrR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2671 2498356 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB