RegulonDB RegulonDB 10.7: Gene Form
   

pyrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrS ypdC pyrR

Gene      
Name: pyrR    Texpresso search in the literature
Synonym(s): ECK2377, G7244, b2381, ypdB
Genome position(nucleotides): 2500383 --> 2501117 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.48
External database links:  
ASAP:
ABE-0007857
ECHOBASE:
EB3901
OU-MICROARRAY:
b2381
PORTECO:
ypdB
REGULONDB:
b2381
STRING:
511145.b2381
M3D: pyrR
COLOMBOS: pyrR
PortEco: b2381


Product      
Name: DNA-binding transcriptional activator PyrR
Synonym(s): PyrR, YpdB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.721
Isoelectric point: 5.601
Motif(s):
 
Type Positions Sequence
3 -> 112 VIIVEDEFLAQQELSWLIKEHSQMEIVGTFDDGLDVLKFLQHNRVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRITGML
53 -> 53 D
139 -> 244 INLVKDERIIVTPINDIYYAEAHEKMTFVYTRRESYVMPMNITEFCSKLPPSHFFRCHRSFCVNLNKIREIEPWFNNTYILRLKDLDFEVPVSRSKVKEFRQLMHL
146 -> 242 RIIVTPINDIYYAEAHEKMTFVYTRRESYVMPMNITEFCSKLPPSHFFRCHRSFCVNLNKIREIEPWFNNTYILRLKDLDFEVPVSRSKVKEFRQLM
2 -> 116 KVIIVEDEFLAQQELSWLIKEHSQMEIVGTFDDGLDVLKFLQHNRVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRITGMLQKLE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
GO:0000160 - phosphorelay signal transduction system
GO:0048870 - cell motility
GO:1900192 - positive regulation of single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Tchieu JH., et al., 2001
External database links:  
DIP:
DIP-48228N
ECOCYC:
G7244-MONOMER
ECOLIWIKI:
b2381
INTERPRO:
IPR001789
INTERPRO:
IPR007492
INTERPRO:
IPR011006
MODBASE:
P0AE39
PFAM:
PF04397
PFAM:
PF00072
PRIDE:
P0AE39
PROSITE:
PS50930
PROSITE:
PS50110
PROTEINMODELPORTAL:
P0AE39
REFSEQ:
NP_416882
SMART:
SM00850
SMART:
SM00448
SMR:
P0AE39
SWISSMODEL:
P0AE39
UNIPROT:
P0AE39


Operon      
Name: pyrSR-ypdC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Tchieu JH., Norris V., Edwards JS., Saier MH., 2001, The complete phosphotransferase system in Escherichia coli., J Mol Microbiol Biotechnol 3(3):329-46


RegulonDB