RegulonDB RegulonDB 10.7: Gene Form
   

ypdC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fryA ypdC pyrR

Gene      
Name: ypdC    Texpresso search in the literature
Synonym(s): ECK2378, G7245, b2382
Genome position(nucleotides): 2501130 --> 2501987 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0007859
ECHOBASE:
EB3902
OU-MICROARRAY:
b2382
PORTECO:
ypdC
REGULONDB:
b2382
STRING:
511145.b2382
M3D: ypdC
COLOMBOS: ypdC
PortEco: b2382


Product      
Name: putative AraC-type DNA-binding transcriptional regulator YpdC
Synonym(s): YpdC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.355
Isoelectric point: 9.428
Motif(s):
 
Type Positions Sequence
201 -> 222 ESVAQFFNITPNHLSKLFAQHG
184 -> 282 HSICNWVQDNYAQPLTRESVAQFFNITPNHLSKLFAQHGTMRFIEYVRWVRMAKARMILQKYHLSIHEVAQRCGFPDSDYFCRVFRRQFGLTPGEYSAR
204 -> 281 AQFFNITPNHLSKLFAQHGTMRFIEYVRWVRMAKARMILQKYHLSIHEVAQRCGFPDSDYFCRVFRRQFGLTPGEYSA
249 -> 272 IHEVAQRCGFPDSDYFCRVFRRQF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[HIFS] Human inference of function from sequence
Reference(s): [1] Fried L., et al., 2013
[2] Perez-Rueda E., et al., 2000
[3] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G7245-MONOMER
ECOLIWIKI:
b2382
INTERPRO:
IPR018060
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR009057
MODBASE:
P77396
PFAM:
PF12833
PRIDE:
P77396
PRINTS:
PR00032
PROSITE:
PS01124
PROSITE:
PS00041
PROTEINMODELPORTAL:
P77396
REFSEQ:
NP_416883
SMART:
SM00342
SMR:
P77396
UNIPROT:
P77396


Operon      
Name: pyrSR-ypdC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Fried L., Behr S., Jung K., 2013, Identification of a Target Gene and Activating Stimulus for the YpdA/YpdB Histidine Kinase/Response Regulator System in Escherichia coli., J Bacteriol 195(4):807-15

 [2] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB