RegulonDB RegulonDB 10.6.3: Gene Form
   

mntH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mntH nupC ypeC CRP CRP OxyR OxyR Fur MntR terminator nupCp nupCp mntHp mntHp

Gene      
Name: mntH    Texpresso search in the literature
Synonym(s): ECK2387, G7254, b2392, mntA, yfeP
Genome position(nucleotides): 2511468 <-- 2512706 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0007889
ECHOBASE:
EB3909
ECOCYC:
G7254
ECOLIHUB:
mntH
MIM:
610446
MIM:
607948
OU-MICROARRAY:
b2392
REGULONDB:
b2392
STRING:
511145.b2392
M3D: mntH
COLOMBOS: mntH
PortEco: b2392


Product      
Name: Mn2+/Fe2+: H+ symporter MntH
Synonym(s): MntA, MntH, YfeP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.194
Isoelectric point: 10.277
Motif(s):
 
Type Positions Sequence
34 -> 34 D
38 -> 384 FATNIQAGASFGYQLLWVVVWANLMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGFKLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELIFSQPNLAQLGKGMVIPSLPTSEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGSRQQRYSATKWDVAIAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYLTLQPLLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTMLPSFIVILMGLDPTRILVMSQVLLSFGIALALVPLLIFTSDSKLMGDLVNSK
112 -> 112 E
239 -> 258 VAIAMTIAGFVNLAMMATAA
351 -> 370 MSQVLLSFGIALALVPLLIF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0015292 - uniporter activity
GO:0046872 - metal ion binding
GO:0015293 - symporter activity
GO:0005384 - manganese ion transmembrane transporter activity
GO:0015086 - cadmium ion transmembrane transporter activity
GO:0046873 - metal ion transmembrane transporter activity
GO:0015078 - proton transmembrane transporter activity
biological_process GO:0071281 - cellular response to iron ion
GO:0006811 - ion transport
GO:0006826 - iron ion transport
GO:0030001 - metal ion transport
GO:0006824 - cobalt ion transport
GO:0006828 - manganese ion transport
GO:0015691 - cadmium ion transport
GO:0055085 - transmembrane transport
GO:0034599 - cellular response to oxidative stress
GO:0070574 - cadmium ion transmembrane transport
GO:0071421 - manganese ion transmembrane transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Patzer SI., et al., 2001
External database links:  
DIP:
DIP-48004N
ECOCYC:
YFEP-MONOMER
ECOLIWIKI:
b2392
INTERPRO:
IPR001046
PANTHER:
PTHR11706
PFAM:
PF01566
PRIDE:
P0A769
PRINTS:
PR00447
PRODB:
PRO_000023258
PROTEINMODELPORTAL:
P0A769
REFSEQ:
NP_416893
SMR:
P0A769
UNIPROT:
P0A769


Operon      
Name: mntH         
Operon arrangement:
Transcription unit        Promoter
mntH


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: Fur, MntR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Patzer SI., Hantke K., 2001, Dual repression by Fe(2+)-Fur and Mn(2+)-MntR of the mntH gene, encoding an NRAMP-like Mn(2+) transporter in Escherichia coli., J Bacteriol 183(16):4806-13


RegulonDB