RegulonDB RegulonDB 10.8: Gene Form
   

yfeN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeR xapA yfeN XapR XapR xapAp xapAp xapBp3 xapBp3 xapBp2 xapBp2 xapBp xapBp

Gene      
Name: yfeN    Texpresso search in the literature
Synonym(s): ECK2402, G7256, b2408
Genome position(nucleotides): 2525127 --> 2525891 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.23
External database links:  
ASAP:
ABE-0007930
ECHOBASE:
EB2952
OU-MICROARRAY:
b2408
PortEco:
yfeN
STRING:
511145.b2408
COLOMBOS: yfeN


Product      
Name: putative outer membrane porin YfeN
Synonym(s): YfeN
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 29.233
Isoelectric point: 6.084
Motif(s):
 
Type Positions Sequence
34 -> 254 HYLDWTSRTTEKSSTKSHKDDFGYLEFEGGANFSWGEMYGFFDWENFYNGRHNKPGSEQRYTFKNTNRIYLGDTGFNLYLHAYGTYGSANRVNFHDDMFLYGIGYNFTGSGWWFKPFFAKRYTDQTYYTGDNGYVAGWVAGYNFMLGSEKFTLTNWNEYEFDRDATYAAGNGGKEGLNGAVALWWNATSHITTGIQYRYADDKLGEDFYQDAIIYSIKFNF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7256-MONOMER
ECOLIWIKI:
b2408
INTERPRO:
IPR018013
INTERPRO:
IPR036777
PFAM:
PF03502
PRIDE:
P45564
REFSEQ:
NP_416903
UNIPROT:
P45564


Operon      
Name: yfeN         
Operon arrangement:
Transcription unit        Promoter
yfeN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB