RegulonDB RegulonDB 10.8: Gene Form
   

zipA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zipA ligA cysZ zipA5\' anti-anti-terminator anti-terminator terminator TSS_2690 TSS_2690 zipAp9 zipAp9 cysZp1 cysZp1 TSS_2689 TSS_2689 ligAp ligAp

Gene      
Name: zipA    Texpresso search in the literature
Synonym(s): ECK2407, G7258, b2412
Genome position(nucleotides): 2530247 <-- 2531233 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.12
External database links:  
ASAP:
ABE-0007942
ECHOBASE:
EB3921
OU-MICROARRAY:
b2412
PortEco:
zipA
STRING:
511145.b2412
COLOMBOS: zipA


Product      
Name: cell division protein ZipA
Synonym(s): ZipA, essential cell division protein ZipA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.475
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
194 -> 317 VIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQ
211 -> 211 L
7 -> 27 LILIIVGAIAIIALLVHGFWT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hale CA., et al., 1997
[2] Lopez-Montero I., et al., 2012
[3] Mateos-Gil P., et al., 2012
[4] Navajas PL., et al., 2008
[5] Vega DE., et al., 2018
External database links:  
DIP:
DIP-1157N
DISPROT:
DP00161
ECOCYC:
G7258-MONOMER
ECOLIWIKI:
b2412
INTERPRO:
IPR036765
INTERPRO:
IPR007449
INTERPRO:
IPR011919
MINT:
MINT-89938
MODBASE:
P77173
PANTHER:
PTHR38685
PDB:
1Y2F
PDB:
1S1S
PDB:
1S1J
PDB:
1F7X
PDB:
1F7W
PDB:
1F47
PDB:
1F46
PDB:
1Y2G
PFAM:
PF04354
PRIDE:
P77173
PRODB:
PRO_000024247
PRODOM:
PD035754
REFSEQ:
NP_416907
SMART:
SM00771
SMR:
P77173
UNIPROT:
P77173


Operon      
Name: zipA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2689 2530551 reverse nd [RS-EPT-CBR] [6]
  promoter cysZp1 2531383 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter zipAp9 2531407 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_2690 2531424 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hale CA., de Boer PA., 1997, Direct binding of FtsZ to ZipA, an essential component of the septal ring structure that mediates cell division in E. coli., Cell 88(2):175-85

 [2] Lopez-Montero I., Mateos-Gil P., Sferrazza M., Navajas PL., Rivas G., Velez M., Monroy F., 2012, Active membrane viscoelasticity by the bacterial FtsZ-division protein., Langmuir 28(10):4744-53

 [3] Mateos-Gil P., Marquez I., Lopez-Navajas P., Jimenez M., Vicente M., Mingorance J., Rivas G., Velez M., 2012, FtsZ polymers bound to lipid bilayers through ZipA form dynamic two dimensional networks., Biochim Biophys Acta 1818(3):806-13

 [4] Navajas PL., Rivas G., Mingorance J., Mateos-Gil P., Horger I., Velasco E., Tarazona P., Velez M., 2008, In vitro reconstitution of the initial stages of the bacterial cell division machinery., J Biol Phys 34(1-2):237-47

 [5] Vega DE., Margolin W., 2018, Suppression of a Thermosensitive zipA Cell Division Mutant by Altering Amino Acid Metabolism., J Bacteriol 200(2)

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB