RegulonDB RegulonDB 10.9: Gene Form
   

murP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murP yfeW murQ MurR murRp murRp

Gene      
Name: murP    Texpresso search in the literature
Synonym(s): ECK2424, G7264, b2429, yfeV
Genome position(nucleotides): 2546673 --> 2548097 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.56
Reference(s): [1] Dahl U., et al., 2004
External database links:  
ASAP:
ABE-0008009
ECHOBASE:
EB3915
ECOLIHUB:
murP
OU-MICROARRAY:
b2429
STRING:
511145.b2429
COLOMBOS: murP


Product      
Name: N-acetylmuramic acid-specific PTS enzyme IICB component / anhydro-N-acetylmuramic acid transporter
Synonym(s): EIIBCNAcMur, Enzyme IIBCNAcMur, MurP, YfeV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.802
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
1 -> 89 MAKEISSELLNTILTRVGGPGNIASCGNCMTRLRLGVHDSSLVDPNIKTLEGVKGVILTSDQVQVVFGPGKAHRAAKAMSELLGEAPVQ
158 -> 178 ALNFMKVFSKGLFTFLVILVG
394 -> 414 FVTACLGGAAGGLFIGLIAWW
115 -> 474 AKFATIFTPLIPGFIAAGLLLGIATLIATVMHVPADAQGTLPDALNFMKVFSKGLFTFLVILVGYNAAQAFGGTGVNGAIIAALFLLGYNPAATTGYYAGFHDFFGLPIDPRGNIIGVLIAAWACARIEGMVRRFMPDDLDMLLTSLITLLITATLAYLIIMPLGGWLFEGMSWLFMHLNSNPFGCAVLAGLFLIAVVFGVHQGFIPVYLALMDSQGFNSLFPILSMAGAGQVGAALALYWRAQPHSALRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFVTACLGGAAGGLFIGLIAWWGLPMGLNSAFGPSGLVALPLMTSAQGILPAMAVYAGGILVAWVCGFIFTTLFGCRNVNLD
261 -> 281 LITLLITATLAYLIIMPLGGW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090588 - protein-phosphocysteine-N-acetylmuramate phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-5
ECOLIWIKI:
b2429
INTERPRO:
IPR018113
INTERPRO:
IPR013013
INTERPRO:
IPR003352
INTERPRO:
IPR001996
INTERPRO:
IPR036878
MODBASE:
P77272
PFAM:
PF02378
PFAM:
PF00367
PRIDE:
P77272
PRODB:
PRO_000023320
PROSITE:
PS51103
PROSITE:
PS51098
PROSITE:
PS01035
REFSEQ:
NP_416924
UNIPROT:
P77272


Operon      
Name: murQP-yfeW         
Operon arrangement:
Transcription unit        Promoter
murQP
murQP
murQP
murQP-yfeW


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: MurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dahl U., Jaeger T., Nguyen BT., Sattler JM., Mayer C., 2004, Identification of a phosphotransferase system of Escherichia coli required for growth on N-acetylmuramic acid., J Bacteriol 186(8):2385-92


RegulonDB