RegulonDB RegulonDB 10.8: Gene Form
   

yfeY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeX yfeY yfeZ ypeA anti-anti-terminator anti-terminator terminator yfeYp yfeYp yfeXp5 yfeXp5 TSS_2746 TSS_2746 yfeXp3 yfeXp3 TSS_2745 TSS_2745

Gene      
Name: yfeY    Texpresso search in the literature
Synonym(s): ECK2427, G7267, b2432
Genome position(nucleotides): 2550641 <-- 2551216 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.87
External database links:  
ASAP:
ABE-0008017
ECHOBASE:
EB3918
OU-MICROARRAY:
b2432
PortEco:
yfeY
STRING:
511145.b2432
COLOMBOS: yfeY


Product      
Name: DUF1131 domain-containing lipoprotein YfeY
Synonym(s): YfeY
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 20.898
Isoelectric point: 5.003
Motif(s):
 
Type Positions Sequence
1 -> 22 MKSLRLMLCAMPLMLTGCSTMS
24 -> 191 VNWSAANPWNWFGSSTKVSEQGVGELTASTPLQEQAIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR
23 -> 191 SVNWSAANPWNWFGSSTKVSEQGVGELTASTPLQEQAIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGTISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLKNWKVSKIIWRR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7267-MONOMER
ECOLIWIKI:
b2432
INTERPRO:
IPR010938
INTERPRO:
IPR038714
PDB:
2QZB
PFAM:
PF06572
PRIDE:
P76537
PRODOM:
PD105195
REFSEQ:
NP_416927
SMR:
P76537
UNIPROT:
P76537


Operon      
Name: yfeYX         
Operon arrangement:
Transcription unit        Promoter
yfeYX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2745 2549935 forward nd [RS-EPT-CBR] [1]
  promoter yfeXp3 2550554 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2746 2550590 reverse nd [RS-EPT-CBR] [1]
  promoter yfeXp5 2550678 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB