RegulonDB RegulonDB 10.8: Gene Form
   

ypeA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amiA yfeY yfeZ ypeA IHF IHF anti-anti-terminator hemFp hemFp TSS_2747 (cluster) TSS_2747 (cluster) amiAp amiAp yfeZp3 yfeZp3 yfeYp yfeYp yfeXp5 yfeXp5

Gene      
Name: ypeA    Texpresso search in the literature
Synonym(s): ECK2429, G7269, b2434
Genome position(nucleotides): 2551713 <-- 2552138 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.64
External database links:  
ASAP:
ABE-0008028
ECHOBASE:
EB3920
OU-MICROARRAY:
b2434
PortEco:
ypeA
STRING:
511145.b2434
COLOMBOS: ypeA


Product      
Name: putative acetyltransferase YpeA
Synonym(s): YpeA, putative acyltransferase with acyl-CoA N-acyltransferase domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.312
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
1 -> 141 MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDEEY
18 -> 123 WERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28085N
ECOCYC:
G7269-MONOMER
ECOLIWIKI:
b2434
INTERPRO:
IPR000182
INTERPRO:
IPR023072
INTERPRO:
IPR016181
MODBASE:
P76539
PDB:
4QVT
PDB:
4QUS
PFAM:
PF00583
PRIDE:
P76539
PROSITE:
PS51186
REFSEQ:
NP_416929
SMR:
P76539
UNIPROT:
P76539


Operon      
Name: ypeA-yfeZ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfeXp5 2550678 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfeZp3 2551921 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2747 (cluster) 2552242 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB