RegulonDB RegulonDB 10.8: Gene Form
   

eutK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutR eutL eutK

Gene      
Name: eutK    Texpresso search in the literature
Synonym(s): ECK2433, G7270, b2438, yffI
Genome position(nucleotides): 2555228 <-- 2555728 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.08
External database links:  
ASAP:
ABE-0008039
ECHOBASE:
EB3922
OU-MICROARRAY:
b2438
PortEco:
eutK
STRING:
511145.b2438
COLOMBOS: eutK


Product      
Name: putative structural protein, ethanolamine utilization microcompartment
Synonym(s): EutK, YffI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.893
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
4 -> 79 ALGLLEVDGMVAAIDAADAMLKAANVRLLSHEVLDPGRLTLVVEGDLAACRAALDAGCAAAMRTGRVISRKEIGRP
17 -> 166 IDAADAMLKAANVRLLSHEVLDPGRLTLVVEGDLAACRAALDAGCAAAMRTGRVISRKEIGRPDDDTQWLVTGFNRQPKQPVREPDAPVIVAESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYRLKPH
1 -> 16 MINALGLLEVDGMVAA
109 -> 162 ESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0003676 - nucleic acid binding
GO:0005198 - structural molecule activity
biological_process GO:0010165 - response to X-ray
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Sargentini NJ., et al., 2016
[2] Tanaka S., et al., 2010
External database links:  
ECOCYC:
G7270-MONOMER
ECOLIWIKI:
b2438
INTERPRO:
IPR032298
INTERPRO:
IPR037233
INTERPRO:
IPR036388
INTERPRO:
IPR020808
INTERPRO:
IPR000249
PDB:
3I71
PFAM:
PF16365
PFAM:
PF00936
PRIDE:
P76540
PRODB:
PRO_000022543
PROSITE:
PS01139
REFSEQ:
NP_416933
SMART:
SM00877
SMR:
P76540
UNIPROT:
P76540


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Tanaka S., Sawaya MR., Yeates TO., 2010, Structure and mechanisms of a protein-based organelle in Escherichia coli., Science 327(5961):81-4


RegulonDB