RegulonDB RegulonDB 10.8: Gene Form
   

eutL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutC eutL eutK

Gene      
Name: eutL    Texpresso search in the literature
Synonym(s): ECK2434, G7271, b2439, yffJ
Genome position(nucleotides): 2555741 <-- 2556400 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.36
External database links:  
ASAP:
ABE-0008041
ECHOBASE:
EB3923
OU-MICROARRAY:
b2439
PortEco:
eutL
STRING:
511145.b2439
COLOMBOS: eutL


Product      
Name: putative structural protein, ethanolamine utilization microcompartment
Synonym(s): EutL, YffJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.788
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
36 -> 107 SLGLISADSDDVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMIAHI
160 -> 208 YGIDAALKSADVQLATYVPPPSETNYSAAFLTGSQAACKAACNAFTDAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0031469 - polyhedral organelle
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
External database links:  
DIP:
DIP-9536N
ECOCYC:
G7271-MONOMER
ECOLIWIKI:
b2439
INTERPRO:
IPR037233
INTERPRO:
IPR009193
INTERPRO:
IPR030983
INTERPRO:
IPR000249
PDB:
3MPV
PDB:
3I82
PDB:
3GFH
PDB:
3I87
PFAM:
PF00936
PRIDE:
P76541
PRODB:
PRO_000022544
REFSEQ:
NP_416934
SMART:
SM00877
SMR:
P76541
UNIPROT:
P76541


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB