RegulonDB RegulonDB 10.8: Gene Form
   

yffR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yffS yffR yffQ TSS_2748 TSS_2748 yffSp4 yffSp4

Gene      
Name: yffR    Texpresso search in the literature
Synonym(s): ECK2444, G7279, b2449
Genome position(nucleotides): 2563980 --> 2564372 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.02
External database links:  
ASAP:
ABE-0008074
ECHOBASE:
EB3931
OU-MICROARRAY:
b2449
PortEco:
yffR
STRING:
511145.b2449
COLOMBOS: yffR


Product      
Name: CPZ-55 prophage; uncharacterized protein YffR
Synonym(s): YffR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.554
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
1 -> 19 MKVLGNILWWAFVGFMAYA
20 -> 130 TLIKPDNTDPAVVNYEEPLPMELANYGEPGEGAKIMNAAKIMGRDYAWKHVKEDRLPCLFAAGVVADNILVKYHFSNETEFKLKAAAVRECANVAENNGFVLVGRVFEKRN

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7279-MONOMER
ECOLIWIKI:
b2449
PRIDE:
P76549
REFSEQ:
NP_416944
UNIPROT:
P76549


Operon      
Name: yffQR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yffSp4 2564400 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2748 2564868 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB