RegulonDB RegulonDB 10.8: Gene Form
   

eutJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutE eutH eutG eutJ eutA

Gene      
Name: eutJ    Texpresso search in the literature
Synonym(s): ECK2449, G7284, b2454, yffW
Genome position(nucleotides): 2569501 <-- 2570337 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.66
External database links:  
ASAP:
ABE-0008089
ECHOBASE:
EB3936
OU-MICROARRAY:
b2454
PortEco:
eutJ
STRING:
511145.b2454
COLOMBOS: eutJ


Product      
Name: putative ethanolamine utilization chaperonin EutJ
Synonym(s): EutJ, YffW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.082
Isoelectric point: 5.143
Motif(s):
 
Type Positions Sequence
141 -> 246 VVDIGGGTTGIAIVKKGKVTYSADEATGGHHISLTLAGNRRISLEEAEQYKRGHGEEIWPAVKPVYEKMADIVARHIEGQGITDLWLAGGSCMQPGVAELFRKQFP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7284-MONOMER
ECOLIWIKI:
b2454
INTERPRO:
IPR013366
MODBASE:
P77277
PFAM:
PF14450
PRIDE:
P77277
PRODB:
PRO_000022542
REFSEQ:
NP_416949
SMR:
P77277
UNIPROT:
P77277


Operon      
Name: eutNEJG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB